2LOR


Conserved Protein Domain Family
TMEM141

?
pfam15110: TMEM141 
Click on image for an interactive view with Cn3D
TMEM141 protein family
The function of this family of transmembrane proteins, TMEM141, has not, as yet, been determined. Members of this family remain uncharacterized. TMEM141 protein family is found in eukaryotes. Proteins in this family are typically between 103 and 124 amino acids in length. There are two completely conserved residues (C and W) that may be functionally important.
Statistics
?
PSSM-Id: 317521
View PSSM: pfam15110
Aligned: 19 rows
Threshold Bit Score: 112.063
Threshold Setting Gi: 780058138
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2LOR_A          6 LSRVDDAVAAKHPGLGEYAACQSHAFMKGVFTFVTGTGMAFGLQMFIQRKFPYPLQWSLLVAVVAGS--VVSYGVTRVES 83
gi 121955766    4 IRRLKEQQKDKHPAFGSYLECMTRALFTGLATFTLGFSSIYFLQKLVAKRLPYPQKSAILVSTVIGT--VASYKVTADRT 81
gi 157118000    4 IRRLKEQQKDKHPAFGSYLECMTRALFTGLATFTLGFSSIYFLQKLVAKRLPYPQKSAILVSTVIGT--VASYKVTADRT 81
gi 347970994    4 IRQLKDQQRDKHPGFDSYIECMSRSLFTGLATFSLGFAGIYFLQQIGQRYLPYTKKGNILVATLVAT--GAAYKVTSDRT 81
gi 780058138    6 ITDLDDDV---YPGVQEYARCQSKAFLKGFIGFVAGGAAGLTASIYARQRYAARFTPSHTVSAIAGGaiVFGYLAASIAS 82
gi 281362567    4 IKRLKDQQREKHPGFDGYMDCMTRSLFTGLATFCLSFSGTYFAQKIVQSKIRYPIKYNILISSLVAT--GVSYQITSTRT 81
gi 195036622    4 IKQLREQQRDKHPGFDGYLDCMTRALFTGLASFCLGFAGTYFVQKAVQTRIHYPAKFNVLVSALVAT--GISYQTTTTRT 81
gi 1043402252  34 LSHVEDAVAAKHPGLAEYAGCQSHAFMKGVGTFITGSGAAFVVQKALNTRLPYPLQWSILLSVVAGS--VASYAITRRET 111
gi 573905795    6 LSRVDDAVAEKHPGLREYAACQSRAFMKGIGTFVLGSAAVFFLQRALHRRLPCSLQWSLLLSLGAGS--VCSYAVTRSET 83
gi 557013039    6 ISRVDDAVADKHPGLQQYAACQSHAFMKGTGTFFLGTGGIFMLQKIINKRFPYPLQWSVLVSVVAGS--VASYAVTRVET 83
                          90
                  ....*....|...
2LOR_A         84 EKCNNLWLFLETG 96
gi 121955766   82 KSCQAGWMAAEDK 94
gi 157118000   82 KSCQAGWMAAEDK 94
gi 347970994   82 RACQARWMAVEEK 94
gi 780058138   83 RDCQKNWVRMaqa 95
gi 281362567   82 KACQAAWMAFEDK 94
gi 195036622   82 KSCQAAWMAFEDK 94
gi 1043402252 112 QRCSDLWMYLEAA 124
gi 573905795   84 QKCSDLWIYLETG 96
gi 557013039   84 KRCSDLWIYLETG 96
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap