Conserved Protein Domain Family
UPF0697

?
pfam15117: UPF0697 
Uncharacterized protein family UPF0697
This family of uncharacterized proteins is found in vertebrates. Proteins in this family are typically around 100 amino acids in length.
Statistics
?
PSSM-Id: 317526
View PSSM: pfam15117
Aligned: 5 rows
Threshold Bit Score: 146.254
Threshold Setting Gi: 308079997
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 294862422  10 DDGTIDYSVHEAWNEATNVYLIVILVSIGLFMYARKNKRKIMRIFTVPPTAESATEANFYDDMKKIRLRQQLEMYYIARK 89
gi 847168234  53 DDGTIDYSVHEAWNEATNVYLIVILVSIGLFMYARKNKRKIMRIFTVPPTAESATEANFYDDMKKIRLRQQLEMYYIARK 132
gi 308079997  18 DSGAIDYSVHEAWNEATNVYLLVVLASLALLVYTRRNKRRILRIFTLPPAAETPAEPNFYNSMKKIRLRQQLEMYSIARK 97
gi 734634435  10 EHESIDYSVHEAWNEATNVYLLVILVSFGLLMYARKNKRKIMRIFTLPPTVGSSPEPNFYDSLQKVRLRQQLEMYSLARK 89
gi 554523292  10 DDGSIDYSVHEAWNEATNVYLVVILVSFGLFMYAKRNKRKIMRIFSVPPTAETLSEPNFYDTMSKIRLRQQLEMYSISRK 89
                         90       100
                 ....*....|....*....|.
gi 294862422  90 HE---------QNDSIQLTVE 101
gi 847168234 133 HE---------QNDSIQLTVE 144
gi 308079997  98 YEqqqqqqppkQTESVQLSVE 118
gi 734634435  90 FEqq-----qgQTDSVQLSME 105
gi 554523292  90 YDhqq---pqnQADSVQLSLE 107
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap