Conserved Protein Domain Family
DUF4560

?
pfam15118: DUF4560 
Domain of unknown function (DUF4560)
This family of proteins is functionally uncharacterized. This family of proteins is found in eukaryotes. Proteins in this family are typically between 66 and 78 amino acids in length. There are two conserved sequence motifs: FCK and RTL.
Statistics
?
PSSM-Id: 317527
View PSSM: pfam15118
Aligned: 6 rows
Threshold Bit Score: 100.676
Threshold Setting Gi: 551514839
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 81889682   4 ALSGLAVRLSRSAAAr-SYGVFCKGLTRTLLIFFDLAWRLRINFPYLYIVASMMLNVRLQVHI 65
gi 551514839  3 GLSYLVLRFSGSAGR--TYGVFCKGLTRTLLIFFDLAWRLRIRFPYIYLVASMVFNVRLQVHI 63
gi 254540185  6 ALSGVAMRLSRSATTrgSYGAFCKGLTRTLITFFDLAWRLRMNFPYFYIVASVILNVRLQVHI 68
gi 545546356  6 APSSLALKACSTAGVpsSYGVFCKGLSRTLLAFFELAWQLRMNFPYFYVAGSVILNIRLQVHI 68
gi 254540194  6 APSALALRAVGPAAAt-PYGVFCKGLSRTLLAFFELAWQLRMNFPYFYIAGSVILNIRLQVHI 67
gi 914924359 11 ALSGQTVWLSRFASVrgSYSAFCKGLTRTLITFFDLAWRLRTNFPYCYVLASVILNVRLQVRI 73
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap