Conserved Protein Domain Family
DUF4562

?
pfam15123: DUF4562 
Domain of unknown function (DUF4562)
This family of proteins is functionally uncharacterized. This family of proteins is found in eukaryotes. There is a conserved HRYQNPW sequence motif. This family includes the human protein C4orf45.
Statistics
?
PSSM-Id: 317532
View PSSM: pfam15123
Aligned: 19 rows
Threshold Bit Score: 170.209
Threshold Setting Gi: 156380481
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_005607851  22 GPDYKKDHLPKVHRDTSYIGEKRPALEKTGDLRYLWRPASDKSFSARYKHEYVGEIGWRIPEYDFINKTRLETGFHFKYG 101 horse
XP_012407593   9 GPDGIKDYKAKCPANTTYTGEKRPVLGATSDLNYLWRAAPKRSFAPIQKHFYVHEIGWGIPELSCINESRLTTGVNIKRG 88  Tasmanian devil
XP_007671238  22 GPDGIKDYRPKIHDFTRFIGEKPPALDVTSELRYLWRPAPRNCFTPAHRSNYVGEIGWAANQLGF-HQMNLQSGKNIKLG 100 platypus
XP_007496236  23 GPEAKKDYKPKIPLYTKYIGEKSPVLETTTELDYLWRPAPNKNFIAREKHFYVGEIGWGIPALSYTNDSRLQTGWNKKQG 102 gray short-tail...
XP_001233138  59 GPDGIRDHRTRRPEHTHYIGATSPAIEGSSDAGYLWRPASCFSSPLLRRCQYAREIGWGVRELSYFTWRNLQSGAQIKRG 138 chicken
XP_015200068  24 GPDGIGDYRVRVADFPRYIGVGTLSPEGTSELDYMHRAAP-GTPAPMPKHCYVGGVGWGVQEYSALNARNLHSKMQFQLA 102 spotted gar
XP_002121517  39 GPDGITDQRVTVEEDNRYVGIGTMSPEGTSELAYLYRPDWRNSPAVLPKHKRVGEIGWGIPKYS--DRSYLYTGRQIKRG 116 vase tunicate
XP_012952105  44 GPDAIRDHRTRRAEHTHYIGETSPAIEGTSDANYLWRPASCSRTPP-RRSDCPGEIGWGVRELSHFARKNLQSGAQIKRG 122 mallard
XP_015716383  55 GPDAIRDHRTRRPEDTHYIGATSPAIEGSSDAAYLWRPAPFFPPPMYRRCQYAREIGWGVRELSCFTWRNLQSGAQIKRG 134 Japanese quail
XP_005629438  22 GPDYIKDHVPKVHQHTSYIGEKRPVLEKTGDLRYLWRPASKRSLPAKYKYEYVGEIGWGIPKYDFISKSRLRTGFHIKYG 101 dog
XP_005607851 102 EVSEAAIDEISHRHQNPWQPKPCIMDALGKYS 133 horse
XP_012407593  89 EFRKRVEEIISHRYQNPWYPKPQILDLQGPGS 120 Tasmanian devil
XP_007671238 101 EFRNASEKRATHRYQNPWQPKPEILDQQGAGS 132 platypus
XP_007496236 103 EFHKAAEDLLSHRYQNPWYPNPQILDLQGAsr 134 gray short-tailed opossum
XP_001233138 139 QIWQAAEDEATHRYQNPWQPAPWVLEHQGRGA 170 chicken
XP_015200068 103 EFRQACEERVTHSYQNPWQPPPRVLNEQSAGA 134 spotted gar
XP_002121517 117 EFRQSAEDRHTHLYQNPWTPKPQYNKTkrprt 148 vase tunicate
XP_012952105 123 LIWQAAEDQATHRYQSPWQPAPYILEQQGHGA 154 mallard
XP_015716383 135 QIWQAAEDQATHRYQNPWQPAPWVLDYQGPGA 166 Japanese quail
XP_005629438 102 EISQATIDKISHRYQNPWQPKPYIMDMQGKYS 133 dog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap