Conserved Protein Domain Family
FANCD2OS

?
pfam15124: FANCD2OS 
FANCD2 opposite strand protein
This family of proteins of unknown function gets its name from its position in the mammalian genome: Fanconi anemia group D2 protein opposite strand transcript protein.
Statistics
?
PSSM-Id: 317533
View PSSM: pfam15124
Aligned: 8 rows
Threshold Bit Score: 280.913
Threshold Setting Gi: 637367839
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2_pfamImport   1 GYQLWSPWSPLDESLQWLRHTTP--TFASKHPF-RF-SPFFPQSPCDVEVQQCFHEVAVVSVMPRMIAARSSELPGHPLE 76
5_pfamImport   1 GYQLWSPWTPLDENLRWLRHTTP--TLCSKHPF-RG-SPLFPKSPSDLEVQQCFQEVAVVLDSPPLENGESRDSAGQASE 76
7_pfamImport   1 GYELWAPWTPLDESFQWIRQTR---TRPSRRPL-RS-SRFFLHTPTDLEVDLCFQEVALVEDRP--DVGFSQKPHSYPSE 73
6_pfamImport   1 GYQLWSPWTPLDESFQWLRHTTP--TPSSKHPF-KA-SPCFPHTPSDLEVQLCFQEVTLVLDSPFLESGVSPKLPCHTSE 76
1_pfamImport   1 TYQLWSPWSPLDDNLQWLRQATP--QKFSKHPF-RG--EWSSVYTADVEMQACFHEIHINQDK-VIKAGHSPNFARHVMH 74
4_pfamImport   1 GYQLWAPWSPLDESLQWLRGAVPr-PSSTKHPF-RG--GPSPATTTDLEEQLCFQGLNLVLEPSAKSGGRTLPALGVAAE 76
gi 620978935  25 GYQLWSSWTPLDESFQWIRHPV---ARPSEGPS-TS-LVSLSETPTDKEVQHHFRKITSVRDGSRLDRNESSHLSPTSKS 99
gi 637367839   4 EYQLWAPHSPLDESLRWLRGPPPraTFSTRPPFpRGrSPDAAVTAADLEVQLCFQGLSLVLEPGV--KGATRPAFRAAGE 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2_pfamImport  77 PQk------gTAAKKtptIRKPQPIRLLGVDSVFGRVITVQPPKWTGTFKISKTSAFSKIISKEQQWPTGLKEPQIEMTL 150
5_pfamImport  77 PE--------TTDKKyglVRKPEPIRLIGVDSVFGRDITVQPPKWTGTFRVSDTSAFSKIISKEQKWPTGLKDPQNEMTV 148
7_pfamImport  74 VRa------tVSPND---IFKPQPVKLCGLDSVFGRIITVQAPRWTGTFRVSDRSAFSKVIARDHVWPTGLKEPQIQMMM 144
6_pfamImport  77 LR---------TMNNkglVRKPQPIRLSGVDSVFGRVITAQPPKWTGTFRVSDKSAFCKIISREHQWPIGLKEPQIQMTV 147
1_pfamImport  75 PKn------iQSK-----ILKPQPVRLIGLDIVLGRMVTSQPPKRTGSFRVSEKSAFSRVIIPKNTWPEGLKEEQTEIAI 143
4_pfamImport  77 TKg------cSAA-----LHKPQAVRLTGLDSVFGHLVTAQPPQWTGSLRVSERSAFCQVISPQQRRPHGLREPQVRMAM 145
gi 620978935 100 PKlprimehrTANDTkngLMKPQPVRLSGLDSVFGRVITAQPPKWTGALRFSEKSAFSKIVSPGQQWPTGLKEPQTEMIF 179
gi 637367839  82 ARg------qVTR-----VQRPQAVRLRGLDTVFGQRVTVRPPRWTGSLRASEPSAFRPVVSPRQRWPRGLREPQAHAAT 150
                        170       180
                 ....*....|....*....|....*...
2_pfamImport 151 AMCKQMLRSILLLYAIYKKCTFALQHSQ 178
5_pfamImport 149 AMCKQMLRSILLLYALYKKCTFVLQHSQ 176
7_pfamImport 145 SICKQLLRSILLIYANYKTCTFALKHSR 172
6_pfamImport 148 TMCKQMLRSILLLYATYKKCTFALQHSK 175
1_pfamImport 144 DICKKLLRSILLLYAIYKKCSFVLQHSK 171
4_pfamImport 146 AMCRQMLRAILLLYAAYKKCAFALQHSR 173
gi 620978935 180 GMCKQMLRAILLLYSTYKKCTFILQHSK 207
gi 637367839 151 NLCRQMLRAILLLYAAYKKCAWTLQHSc 178
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap