Conserved Protein Domain Family
UPF0515

?
pfam15135: UPF0515 
Uncharacterized protein UPF0515
This family of proteins is functionally uncharacterized. This family of proteins is found in eukaryotes. There are two conserved sequence motifs: PLT and HSC.
Statistics
?
PSSM-Id: 317541
View PSSM: pfam15135
Aligned: 8 rows
Threshold Bit Score: 236.639
Threshold Setting Gi: 754350729
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189042261   18 REKFHGLIEIDTAVL------LMRRYVKNHRMVAMWIALMADNd---rELDEEDQAALNNDPVAKNVIMKLKaeeqqqee 88
gi 189042262   19 REKFHGKVTLETAVA------LMRRFTNNHDQVCKYIILCMDN-----DTDLDVRNDLRNDPVARNVINKIKsddqk--- 84
gi 122146096   16 REKFHGKVSSKKAGT------LMRKFGSDHTGVGRSIVY---------GVKQKDGQELSNDLDTQDPPEDMK-------- 72
gi 612010306   19 REKFHGHVSVKKANV------LMQRYNDNHNLVASWLVKQM-N-----DIRPEEGDGHQPDPIVQDRQNVL--------- 77
gi 1033375076  19 REKFHGKVDIPDAVV------LMRQFSNNHDLACKRIILCKDElddepDMDPEGRGRLGNDPVAQKVMDKLKkeeerk-- 90
gi 754350729  113 RRKNNNR-PADSAGAaqprrgLPRRRRGGAPVAALAAANAPVAaagdfDLGDAPQGALVDFGAMRNglpp---------- 181
gi 612010308   19 REKFHGHVSVKKANV------LMQRYNDNHNLVASWLVKQMN------DIRPEEGDGHQPDPIVQDR------------- 73
gi 597733644   18 RENFHGKIPVDKATV------LMRRYRNNHRMVAMEIILMKDR-----DLDEEDKWSLENDTVVRNVVQKLQteereqse 86
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189042261   89 khakssss--gssgagpsakakkqpsDDRDITELGTR-LRVLPLTMENKRMFDQAQANQIPSDTHQFACESCDRDWWRRV 165
gi 189042262   85 ---------------------akempKDKDIKDLAKR-MNTLPLTEKNLKMFNDAAENRIPSRDRQFACKECDFVWWRRV 142
gi 122146096   73 --------------------------QDRDIQAVATS-L--LPLTEDNLRMFQRAQEDLIPAVDRQFACSSCDHVWWRRV 123
gi 612010306   78 --------------------------QDRDIEEVAAT-MS-LPLTEKNLRMLDDAQKGHIAKEDCQFACQPCDFMWWRRV 129
gi 1033375076  91 --------------------kqasdnENDKIKDIAQQ-LKVLSLTEENLRMFNQAKNNQILTRDRQFACQPCDIMWWRRV 149
gi 754350729  182 ----------------------ngpsAPSSVSSVASSkASRKPLTERNVAIKDRSHYQL-----YMFGCEGCSMLWYKKC 234
gi 612010308   74 -----------------------------DIEEVAAT-MS-LPLTEKNLRMLDDAQKGHIAKEDCQFACQPCDFMWWRRV 122
gi 597733644   87 rdarssgasddskrskqpktskqgtiKDRDIEELGKR-LRVLPLTEKNMRMFDHAQKNLMPSVIHQFACETCDQVWWRRV 165
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189042261  166 PQRKRVSRCHRCKKKNDPVP-PDRMWGIAEFTCPNCTRNFKGF-GRMDGRSPCYGCRSAIY----PMKILPPR--RKnmm 237
gi 189042262  143 PQRKEVSRCHRCRKKFDPVP-ENKMWGIAEYHCPVCRRMFRGF-GQIEVSSPCYVCRNPVL----PSCILPPR--RN--- 211
gi 122146096  124 PQRKEVSRCRKCRKRYDPVP-SDKMWGVAEFHCPKCRHNFRGW-AQMGSRSPCYGCGFPVY----PTRILPPRwdRD--- 194
gi 612010306  130 PERKKVSRCRKCKVKYDPVP-KDKMWGIAEFQCLQCGHTFKGF-AQMGNPSPCYSCGNPVL----PNRILPPR--RP--- 198
gi 1033375076 150 PKRKEVSRCHRCGTCYDPVP-CKKMWGYAEFECPSCQRTFKGF-GQMEVPSPCFGCHNTVF----PSRILPPR--RT--- 218
gi 754350729  235 APINPVSPCRGCNTRYDPIPiGSEPVGLGFFRCSKCKHQWTSCpAARNVSQPCFGGKCVMLhheyPYKVLPRQsmRShtd 314
gi 612010308  123 PERKKVSRCRKCKVKYDPVP-KDKMWGIAEFQCLQCGHTFKGF-AQMGNPSPCYSCGNPVL----PNRILPPR--RP--- 191
gi 597733644  166 PQRKRVSRCRRCKKKYDPVP-PHKMWGIAEFFCLNCSRSFKGF-GRMDIGSPCYICRSIIL----PTQILPPR--RNmrd 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189042261  238 PGPKQR-NQHSCFAEDCYHRMEPHVPGTECVHPHSRQKNRKPRVVYPSPAHISSGSTVNTCLSQGSLIE-SINELILDDI 315
gi 189042262  212 QGPRTR-NTHSCLAENCYNRRVPFVAGLQCAHPKSRIMNQLPKVLHPSEPHISTGSTIATCLSQGSLTEnDIDDIILDDI 290
gi 122146096  195 PDRRST-HTHSCSAEDCYNRREPHVPGTSCAHPKSRKQNHLPKVLHPSNLHISSGSTVATCLSQGGLLE-DLDNLILEDL 272
gi 612010306  199 QNERSRkHEHSCFAETCYNRQGSYEPGTSCVHPKSRKQKHMPVVLFPSAVHDSSGSTVATCLSQGSLIE-DLDSIILEDI 277
gi 1033375076 219 QGPRSR-HQHSCFAEDCFNRREPHVPGTHCVHPQSLRRNRLPKVLFPSEEHDSTGSTVDTCVSQGSLQV-DLDYLIledl 296
gi 754350729  315 ETQRKSdNKHSCAA--C---------GGEGQCPLRRRGDVF------SKAHVSAPGSIGCSSSPGS----ERNWLSDENY 373
gi 612010308  192 QNERSRkHEHSCFAETCYNRQGSYEPGTSCVHPKSRKQKHMPVVLFPSAVHDSSGSTVATCLSQGSLIE-DLDSIILEDI 270
gi 597733644  238 QGPRRR-QQHSCLAEDCYNRQEPHVTGTECVHPRSRQKNNKPQVVNPSLPHISSGSTVNTCLSQGSLLE-QVYELILDDI 315
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap