Conserved Protein Domain Family
DUF4571

?
pfam15137: DUF4571 
Domain of unknown function (DUF4571)
This family of proteins is functionally uncharacterized. This family of proteins is found in vertebrate. This family includes human protein C21orf62.
Statistics
?
PSSM-Id: 317543
View PSSM: pfam15137
Aligned: 12 rows
Threshold Bit Score: 307.428
Threshold Setting Gi: 973190819
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 281371552   6 RHCLLLISTLGVFAL-----NCFTKGQKNSTLIFTRENTIRNCSCSADI--RDCDYSLANLMCNCKTVLPLAVE----RT 74
gi 254911037   6 RHCLLLISTLGVFAL-----NCFTKGQKNSTLIFTRENTIRNCSCSADI--RDCDYSLANLMCNCKTVLPLAVE----RT 74
gi 637283901  13 RHYLFLVGLLN-FCG-----DSFAQGQMNNTLIFIKENAIRNCICPDDMsdNDCDYSLANLICNCKTVLPSMID----KT 82
gi 52345684    4 NPCLFLFSFLSFGLA-----RNLVSGQ-NSTLLFPKDNNVRNCSCSTEI--KSCEYSLANLMCNCKSQYPS-------RI 68
gi 973190819   6 lTFLLLISAL---CG-----RPAVAKHPNSTLLYDRNNSIRNCSCASEI--QHCSHAQANILCSCRTIPRSSLNsvnvGL 75
gi 157817911   6 SFCLLL-GALGIFAL-----GRFAEGQ-SRTLIFTKGNTIRNCSCPADI--RDCDYSLANLMCSCKSVLPLAME----QT 72
gi 655855765   6 GHCLLLLGTLGVFVL-----QRGTAGQKNSTLILARENAIRNCTCSADI--RDCDYSLANLMCSCKTALPLAVE----RA 74
gi 254911052   6 GHSLLLTSALGIFIL-----HCFTRGQKNSTLIFTKENIIRNCSCSADV--QDCDYSLANLMCSCKTVLPFAIE----QT 74
gi 410970074   6 GHSLLLTSALGILVL-----GCFTGGQRNSTLIFTKENTIRNCTCSADV--RDCDYTLANLMCSCHTVLPSAIE----QT 74
gi 254911045   6 GHSFFLIGALGVFAL-----NCFTRAQRNGTLIFTKENTIRKCSCSADI--RDCDYSLANLMCSCKTMLPLAIE----QT 74
gi 733872727  12 wlALFLAGFLGICIT-----DSFMGSQKNHTLIFTRESNIRNCSCLADI--RDCDYSLANLLCNCRTVLPSTME----KT 80
gi 524981526   6 cpafsICLALILARFlgihtSFVR-SQKNHTLIFTKENTIRNCSCSVAI--HDCDYCLANLMCNCKTVLPSTME----KT 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 281371552  75 SYNGHLTIWFTDTSALGHLLNFTLVQDLKLSLCSTNTLPTEYLAICGLKRLRINMEAKH-PFPEQSLLIHSGGDSDSREK 153
gi 254911037  75 SYNGHLTIWFTDTSALGHLLNFTLVQDLKLSLCSTNTLPTEYLAICGLKRLRINMEAKH-PFPEQSLLIHSGGDSDSREK 153
gi 637283901  83 HY-SNLTIWFTEPSILGMLLNITAIYDLKLSFCGSIPVSSKYLVIWELRRLQIRSEING-QLQEQILTICSSSDYEPHAK 160
gi 52345684   69 SYTGDLVVWFTNTSILGQLLNFTLVQDLKLSLCGALPLPTDYLAIIGLRRLEVHTANST----EQRLIIYNH-DMKPMDK 143
gi 973190819  76 TYQGGLTVWVEDPWVLKDLVNHSCVQDLRLAACGSSPLPPEYLTLFDLKRLHIYNNAAGvRFPEQGLTITTLERSHEMSN 155
gi 157817911  73 SYHGHLTIWFTDISTLGHLLKFTLVQDLKLSLCGSNTFPTKYLAVCGLKRLHINTEAKH-PSGEQSILIHNGregSS--- 148
gi 655855765  75 SYHGHLTVWFTDTSALGRLLNFTLVQDLKLALCSTNTLPAAYLAICGLRRLRINTESKY-ASAEQSLLIRGGgdgDT--- 150
gi 254911052  75 SYDGHLTIWFTDTSALGLLLNFTLVRDLKLSLCGTNTLPTEYLAICGLKRLRINAEARG-PSLEQSLLIYNNgesEPREK 153
gi 410970074  75 SYDDRLTVWFTDASALGLLLNFTLVRDLKLSLCSPNTLPAEYLAICGLERLRVNTEARR-PLPEQSLLIHDGresEPGEK 153
gi 254911045  75 SYSDRLTIWFTDTSALGLLLNFTLVRDLKLSLCSTNTLPTEYLAICGLKRLRVSTEAKH-PSPEQSLLIHDGgesEPREK 153
gi 733872727  81 DYNSDLTIWFTDTSVLEMLLNFTMVWDLKLSFCGTTPLPTEYLTIWGLRKLRVKNKVKG-QFPEQSVTIYSSsknEKEDL 159
gi 524981526  79 TYNSHLTIWFTDTSVLEMVLNFTRVWDLKLSFCGITPLPTEYLAIWGLGKLRVN-KIKG-QFPEQSVTISSSsssNK-DL 155
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 281371552 154 PMWLHKGWQPCMYISFLDMALFNRDSAFKSYSIENVTSIANNFPDFSYFRTFPMPSNKSYVVTFIY 219
gi 254911037 154 PMWLHKGWQPCMYISFLDMALFNRDSALKSYSIENVTSIANNFPDFSYFRTFPMPSNKSYVVTFIY 219
gi 637283901 161 FKMSCSDRNMNNHIAILDISLFNGYAPLKSYSVENISNITERFPKLPHLDTYFT-RNNSFIVTFIY 225
gi 52345684  144 TSQHPREKTSLFHISYLDTSLFNGQS-LKAYSVEDVSSINEQFPNLPYPNAFSV-TNTSYVVTLIY 207
gi 973190819 156 IPP--------FQVSFLNVALLNGISLLKAYSVKNLPTIGEYFPNLPLPVSTEPAESQHCQVTFIY 213
gi 157817911 149 ---LYKGWQTRVFISLLDVALFNRDSSLKSYSIDDISSLTGDFPDFSYFITFPVPNNRSYLVTVIY 211
gi 655855765 151 -----EGWPSCLHISFLDVALFNRDSSLKSYSVENVTSTAHDFPDFSYFKTFPVASNASCVVTVIY 211
gi 254911052 154 IMLLHKGWQTCMYISFLDMALFNRKSSLKAYSIENVASIANTFPYFSYFETIPILSNKSYVVTFIY 219
gi 410970074 154 PARLPGGRHTCMCISFLDVALFNGNSSLKAYSIENVANTTNHFPHFSYFETFPILSNQSYVVTFIY 219
gi 254911045 154 PT-LQRGWQTCMYLSFLDMALFNRESALKSYSVANSASVANNFPYFSYLKTFPVLNNKSYVVTFIY 218
gi 733872727 160 LTMHNKDRQMLVYISFLDTSLFNGYSLLKSYSVENVSSITEHFHNLLYSNVFSNSDNKSYVVTFIY 225
gi 524981526 156 LEMHNKDRQMLAHISFLDTSLFNGYSMVKSYSVENVSSIMKHFPSLLYSDVFSTSDNESYVVTFIY 221
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap