Conserved Protein Domain Family
INCA1

?
pfam15142: INCA1 
INCA1
This family of proteins inhibits cyclin-dependent kinase activity.
Statistics
?
PSSM-Id: 317548
View PSSM: pfam15142
Aligned: 13 rows
Threshold Bit Score: 285.93
Threshold Setting Gi: 351710631
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121940471  12 PFAKCSRVVSRSPPPRLPSQSLRPMPQRYGDVFWKNLNQRPTPT--WLEEQHIPPMLRATGCSQLGLY-PPEQLPPPEML 88
gi 351710631   1 PHLRCSRVVLRSPPASLPSQGLRLTPNRYGDIFWENLTQRPSRV--WMEEQYIPSMLRATGCSQLGSCpPPEGLPPPEML 78
gi 545179909  25 PFAKCSRVVSRSPPPSLPSQSLRLTPQRYGDIFWENLSQRPSPT--WMEEHYIPPLLratgcsq-pglyppeGLPPPEML 101
gi 344290091  12 PFAKRSRVVSRSPPPSLPSQNLRMTPQRYGDIFWEKLSQRTSPI--WMEEQYIPPMLRATGRSQAGLC-APGGLPPPEML 88
gi 927197819 144 PFAKCSRVVSRSPPPSLPSQSLRLTPRHYGNTFWENLSQKPRPT--WMEEPYTPPLLRVTGCSQLGLY-PPEGLPPPEML 220
gi 296476797  12 PFAKCSRVVSRSPPHCLPSQSLGLMPQHYGDTFWENLSQRPSPT--WMEEQYTPPLLRATGCSQPGQY-GPEGLPPPEVL 88
gi 281343323   1 PLLRCSRVVRRSAPPGLPSQSLGLMPQQYGDLFWDNLSQ--GPSptWPEEQYTPPLLRATGCSQPGLY-PPEGLPPPEVL 77
gi 511881214  26 PFAKCSRVVCRSAPPGLPAQSPGLMPQRYGDLFWENLSQKPSPT--WMEEQYTPPLQRATGCSQPSLY-PPEGLPPPELL 102
gi 545497767  23 whpGCSRVISRSTSPSLPPQHLGLMPQRYRDIFWENLSQRSSPT--WTEEQYAPPLLRVPACSQPGLN-PPEGLPPPEVL 99
gi 587009883  25 PFAKCSRVVSRPAPPRLPSQSLTLMPQRYGDLFWESLSQRPSPT--WTEEWHIPPSPRATGCSQPGLY-PLERLPPPEVL 101
gi 157818865  30 PLPRCSRVVSRSSPCSLPSQKSRPMPQPYGEIFWENLSRRSNSN--WMIEQYIPPILRATGCSQPGLH-PLEGLPPPEKL 106
gi 914923851  27 PFAKCSRVVSRSPPPSLPSQSLTSTSQRYGNVFWENLCQRPSPT--WTEEQYIPPMLRNSGYSQPGLY-PLEGLPPPEML 103
gi 395836662  12 PFAKCSRVVSRSLSPALPSQSPRPMAQRYGAVFWENLSQRPCPT--WKEEKSIPSILRATGFSLPGLH-YPKGLPPPEML 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121940471  89 WRRkKRRPCLEGMqQQGLGGVPARVRAVTYHLEDLRRRQSIINELKKAQWGSSGAASEPVVLGEEGCGFPSTN--EYPDL 166
gi 351710631  79 CRR-RRRPRLDRM-QQGPGGIPARVRAVAYHLEDLRRRQRTINEIKKAQWGISEAAPEPLVVPEGGCGFLSTS--QYPDL 154
gi 545179909 102 CRRkRRRPHLVGT-QQGPGGIPARVRAVTYHLEDLRRRQRIINELKKAQWGSPEATSEPLVPDEEGCEFPSTT--KYPAL 178
gi 344290091  89 CRRkRRKPRLAGV-QQGPVGIPARVRAVTYHLEDLRRRQRIIDELKKAQWGSSGATSEPLVLGGEGPRFSHTT--GYPDL 165
gi 927197819 221 CRRkRRRQHLAGM-QQGSGSIPARVRAVTYHLEDLRRRQRIINELKKAQWGSSGAAPEPLGLDEDGCGQPSTR--RHPDP 297
gi 296476797  89 CRRkRRRPCSGGM-QQGSGGISARVRAVTHHLEDLRRRQRIINELKKAQWGSSGAASGPLLVDSDGCGFPSTT--EHPDR 165
gi 281343323  78 CRRkRRRPHLAGM-QQGPGDIPARVRAVTYHLEDLRRRQRLINEQKKARWGCSGAASEPLALADDRRRVPRATeyEYRGL 156
gi 511881214 103 CRRkRRRPPLAGM-QQGPGGIPARVRAVAYHLEDLRRRQRLINERKNAQWGTSGAASEPLALAHDLGGVPSAT--QYRGL 179
gi 545497767 100 CRRkRRRPQVAGM-QQGPGCIPARVRAVAYHLEDLRRRQRLINEEKKAQWGGSGAACEPLALAEGSNRVPGTS--KYQDL 176
gi 587009883 102 CRRkRRRPHLAGM-QQGPAGIPAQVRAVTYHLEDLRRRQRIINELKKPQWDVSGAAPEPLAPATAGCGVPSAT--EYPGL 178
gi 157818865 107 WRRkGKKLHLERM-QKGLGSTPARVRAVTYHLEDLRRRQGIINELKKAQWGSSEATPE-LPVFEEGCELLSTT--KYLDV 182
gi 914923851 104 CRRkRRRSHLEGM-KQGPGSIPARVRAVSYHLEDLRKRQRTMDELKKAQWGNSRAASEPLVLDEEGCGFPSTT--EYPDL 180
gi 395836662  89 CRRkKKRPHSEGM-QQGPGSIPARVRAVTYHLEDLRRRQRTIDELKKAQWGGSGAAFEPLMLAEEGCGFSSTT--EYPDL 165
                        170       180
                 ....*....|....*....|....
gi 121940471 167 EEERATYPQEEDRFLTPGRAQLLW 190
gi 351710631 155 EKEKATYPQEEDHFIIPGRAQLLW 178
gi 545179909 179 EAERATYPWEEDHFLTPGRAQLLW 202
gi 344290091 166 EEEQPT-----DHFLTPGRAQLLW 184
gi 927197819 298 EEERANSPREEDDLLSPGRAQLLW 321
gi 296476797 166 EEERADYPQEEDHFLTSGRAQLLW 189
gi 281343323 157 EEERAAYLQEDGHPLTSGQPQLLW 180
gi 511881214 180 EEERAAYPQEDGHLLTSGGTQLLW 203
gi 545497767 177 EEERAAYPQEEGHPLTTGRPQPVW 200
gi 587009883 179 EEARATYPQEEGHPLTTGRTQLLW 202
gi 157818865 183 EEERATYPQGENYFVTP-RDQLLW 205
gi 914923851 181 EEEKATYPQEENHFVTPGRDQLLW 204
gi 395836662 166 EGERATHPQEEGHLLTPGRAQLLW 189
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap