Conserved Protein Domain Family
DUF4577

?
pfam15145: DUF4577 
Domain of unknown function (DUF4577)
The function of this family of proteins, has not, as yet, been determined. Members of this family are as yet uncharacterized. This family of proteins is found in eukaryotes. Proteins in this family are typically 128 amino acids in length.
Statistics
?
PSSM-Id: 317550
View PSSM: pfam15145
Aligned: 8 rows
Threshold Bit Score: 196.163
Threshold Setting Gi: 344270458
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123785009   1 MTHSSQDAGSHGI--QEEGRLYVVDSINDLNKLSLCPMESQHLF------SLEDKIPNAGTAPGNG--RRGLFFVGLLLV 70
gi 395539207   1 MNHSALEIGSCDT--HEERKLYVIDSLNDLNKVNFSPAGSQRLFlicftlAQEKKFIGGAPNTGNGirNRSLFFVALIIA 78
gi 344270458   1 MNHSSQDPG---I--HEDGKLYVVDSINDLNKLNLYPAGSQRLF------PLEEKIPAHRGNSGNG--SRSVFLVALIII 67
gi 351703995   1 MNHSFQDTGSCGI--HEDGKLYVVDSINDLNKLNLCPVGSQHPF------PLDEKAPGLGTNSGNG--SRSLFFVGLLIV 70
gi 655826731  30 MNRASQDTGSRER--HEDRKLYVVDSINDLNKLNLCPAESQHLF------PLEEKSPELGTNSGSG--SWSLLFVGLLIV 99
gi 301758482   1 MNHS-QDSGSRGM--PEDRKLYIVDSINDLNKLNLCPAGSQHLF------PLQEKIPDVGTNSGNG--SHSLFFMGLIIV 69
gi 73976615    1 MTHCSPDAGSRGS--PEGRKLYVVDSINDLHKLSLCPAGSQPLF------PPQEELPDTR-DPGHG--GRGLFFMGLITV 69
gi 432112352   1 MHRSPRDSGSRGIpvPEDRKLYVVDSINDLHRLNFCPAGSQHLL------PPEEKTLEAGTRSGDG--RPRLLFLGLVLA 72
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 123785009  71 LTVSLALVFFAIFLIIQTGNQMEDVSRRLTAEGKDIDDLKKINNMIVKRLNQLDSEQN 128
gi 395539207  79 LIVSLTLVSFVIVLLLQTGSKMDEVSRRLTAERKDIDELKKINSMILNRLNQLDAIKN 136
gi 344270458  68 LIISLALVSFVIFLITQTGSKMDDVSRRLRAEAKDIEDLKKINSMIVQRLSQLEPVQN 125
gi 351703995  71 LLVSLTLVFFVIFLIIQTANKMEDVSRRLAAEGKDIDDLKKINNMIIKRLNQLDSEQN 128
gi 655826731 100 LTVSLALVSFAIFLIIQTGNRMDDVSRRLVAEGKDIDDLKKINNMIIKRLNLLDPEQN 157
gi 301758482  70 LIVSLALVSFVIFLIVQTGNKMDDMSRRLTAEGKDIDDLKKINSMIVKRLNQLDakqn 127
gi 73976615   70 LIVSLALVSFVIFLTVQTGNKMDDVSRRLTAEGKDIDELKKINSMIVKLLNQLDAEQN 127
gi 432112352  73 LMVSLVLVALVTFLIIQTGSKMDNVSRRLAAEGRDIDELKKLNSMIVKRLNQLESAQN 130
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap