Conserved Protein Domain Family
DUF4578

?
pfam15147: DUF4578 
Domain of unknown function (DUF4578)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 44 and 137 amino acids in length.
Statistics
?
PSSM-Id: 317552
View PSSM: pfam15147
Aligned: 14 rows
Threshold Bit Score: 203.121
Threshold Setting Gi: 76635157
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81905666    1 MGNRLCCGGTWSCPSTFQKKSKTGSHPRPT---LSIl-KQQQLWQ------NGTKDYETTAPTYEQVLYPPASQKKT-SN 69
gi 532097267   1 MGNQLCCRGSWSCPSTFQKKKKKGNQARLT---LKK--QQQQLQQ------NCTKDHEIRGHMYEQVLQQPKSQKRN-QD 68
gi 431908327  53 vcrmpgaGLEWSCPTIFHRKKKTGNQPRWT---SKQ--QPQQQ--------KGTKGNDTTGHAREGVLEHSASQERS-QG 118
gi 345799948   1 MGNQLCCRGCWNCPSIAQRKKKTGSQARQT---LKQ--QQQQQQQhr--hkHSAKVHNTRGHTYEQVLEKPGSQERS-PG 72
gi 410971891   1 MGNRLCCGGHWSCPSTSQRKKKMESQARRT---LKQ----QQQQQ------NGTKAHDTTGRMYEQVLEKPASQERS-RG 66
gi 301771446   1 MGNRLCCGGSRSCPPTSQRKKKTESKARGT---LKQp-QPQPQPQ------NGVKARDTRGHIYEQVLEKPTSQERS-QG 69
gi 731498362   1 MGNQLCCGRSWSCPSTLQRKKKTGSQPRLSskrRRQqqKLPQQQQ------NGTKGPQTPGHTYERVLEQPEPRQRH-QG 73
gi 334329808   1 MGNQLCCGGSWSCPSSFHKKKKRGSKAR----------GRTEKQK-------STKGPETMGHTYELVSELPRSGEGN-QG 62
gi 291383896   1 MGNQLCCRGSWSCPSTFQKKKRTGSQTRQV---LKA--QPQQLQQ------NGTKDRDTRGHTYERVLQESKFQERS-EG 68
gi 76635157    1 MGNQLCCGRSWSCTSTLQRKKKIGSQARRT---LRR--QQQQPQHewwrqlNDTKDHDTMGHTYEQVLRQPVSQERSrQS 75
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 81905666   70 STSEESDLHYADIHVLRQIRPHSLHTVKCLHSESATEYATLRFPQATPQYDSNNGTLV 127
gi 532097267  69 LKLEESNLHYADIQVNSLTQPRSASEVKHWYLENATEYATLCFPQATPRYDSKNGTLV 126
gi 431908327 119 LRSEESNLHYADIQVCSPTQPRSVGEVKHLQLQNATEYATLCFSQATPCYDSKNGTLV 176
gi 345799948  73 LRSKESSLHYADIQVCSYTQPRSARQVKHLQSENATEYAILRFPQATPRYDSKNGTLV 130
gi 410971891  67 LSVKENSLHYADIQVYSCTQPRSALEVKHLQSENATEYATLRFPQATPRYDSKNGTLV 124
gi 301771446  70 LRREESSLHYADIQVCSSTQPRSALDVKHKQLENATQYATLRFPQATPRYDSKNGTLV 127
gi 731498362  74 FTSEDSSVHYADIRVCSQSQSRSAGEVKHLQLENATEYATLRFPQATPRYDNKNGTLV 131
gi 334329808  63 PQSEDSSLHYADIQVCSRTQPRSAQEVKHLQIENATEYATIRFPQATPHYDSKNGTLV 120
gi 291383896  69 PVSEDSNLYYADIQVYSHNQPRSAQQVKHLHLENATEYATLRFSQATPRYDSKNGTLV 126
gi 76635157   76 LRSEEGSLYYADIQLYRLPQPRSVQEVKHLQLKNATEYATLRFPQVTPRYDSKNGTLV 133
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap