Conserved Protein Domain Family
Apolipo_F

?
pfam15148: Apolipo_F 
Apolipoprotein F
Statistics
?
PSSM-Id: 317553
View PSSM: pfam15148
Aligned: 18 rows
Threshold Bit Score: 275.008
Threshold Setting Gi: 947278807
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71152231   53 LSCQMLLpkSLPGFTYMPPVSKFLVGLALRNALEAAGCQAEVWALQLQLYRLGGVEATQALIHHLQELQKSGHTDREVSV 132
gi 81889142   53 STCRNLL--SMAPLPPVAPLSESLSLLALRVVLENIGCPAEAYSLQLQLREMGGKDSTETLILESQKHSQEEGIGNNEAI 130
gi 122136024  54 KTCQDLL--HV--APSLAPLPEYLSNLALEVVLEEIGCTTEAHILQLQLVKIGGKDTTETLIRESKKHNEGEGTGQVKVI 129
gi 75043223   54 KMCQDLL--HV--VPSLAPLPEYLSNLALEVALEEVGCLTEAHMLELQLVKMGGKDTTETLIRESKKRNEEKGINDGEIM 129
gi 26350411   27 ITCRDLLytVLP----AAPLSEFLSLLALRVVLENIGCPAEAYSLQLRISEMGGKDSAETLVLQSQKSSQEEGIGNNEVI 102
gi 655739201  54 RACQDLL--HM--VPSLAPLPEHLSKIALRVALEEAGCLAEARNLQLQLTRMGAKDITETLIQQSQERREGGGISSTQVI 129
gi 350584118  52 LSCETLLpkSLPGFTHMAPLPKFLIGLSLMIALEKAGCQADVQVLKLQLYRQGGINATEMLIRHLQELEKGRSSGRGVSA 131
gi 586547905  62 SSCQTLLpkSLPGFTQMAALPKFLVGLPLMIALKEAGCHADVRTLQLQLYRQGGVNATQILIQYLQGLEKGRSTGRGVSV 141
gi 831214190  54 RICQHLL--HT--APSLAPLPEYLSTLALRAVLEDIGCPTEAHILQLQFIKLGGKDTSETLIHESQKLNEEERIGHANTV 129
gi 532100126  54 STCQDLL--HT--VPSLAPLPEYLSNLALRVVLEDVGCPAEAHYLQLQLSRVGGKDLTETLIHESQKHTREERTGNNEAI 129
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71152231  133 dalssaLQLLAWEQPGPKRAKRSISNTD-CDNDQEQSVHNVVDL-------L-------PAV-GTYYNLGTALYYAIKNC 196
gi 81889142  131 ------LRHLVASPGEIKRVERSVTVPEaCTSEQGWVLRELAQLlvevaekL-------PSI-DLVREFKASAVNATQQC 196
gi 122136024 130 ------LKDLGRSPGELRRAQRSVTLPEaCRQEDRWVLYETAKMiaefaekL-------PNT-ELVKEFKAAATDVTQKC 195
gi 75043223  130 ------LRGLEGSPGELRRVQRSVTLPEaCQQEGRWVLYELAELigefaekL-------PST-ELVRELKTAAVDVTQKC 195
gi 26350411  103 ------LRHLVPSPGDMRRVRRSLTLPEaCTYEPGWVLYDMAQV-------LletanklPPI-DLVREFKASVVNVTQHC 168
gi 655739201 130 ------LRDLGGSPGELRRARRSAPLPEaCSSRYGWVLHDTSELiaefaekL-------PATeELAAKLKTAALNVTQKC 196
gi 350584118 132 dalssaLQQWAEEQTSPKRARRSLSIKD-CEHEKEQSVHNIVQL-------L-------PGV-GTFYNLGTALYYAVQNC 195
gi 586547905 142 dtlvsaLQLMAKEQPGPERARRSLPSKD-CEYEQEQGVHNIAQL-------L-------PGV-ETYYNLGTALYYAAQNC 205
gi 831214190 130 ------LRDQGGSPGEHRRVQRAVTLSEaCTSSHGWVLSETAKLiaefaekL-------PSS-ELVTELKTSAINVTQKC 195
gi 532100126 130 ------LRDLGGVSGELRRVQRSVTLPEvCASGHGWVMYESAALmikfaekL-------PST-ELVREFKSAAITVTEKC 195
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....
gi 71152231  197 SDKAKERGRDGAIDLGYDLLMAMVGASGGPAGAVITAALKPAMKAGVQRLIQYY 250
gi 81889142  197 TMESWEHMNEVGKRLISNPEIENATIPIEDRVYLISRLTVLLKRVFMSFLRNFF 250
gi 122136024 196 TDESWEYLQAVSNQLVKSPEMKDFTMPMQDQLYFIKRSMTILMHIVVEFIKTQV 249
gi 75043223  196 TDESWQHLEAVGNRLMKNPETKDFTMPMDDQIYFVKRSVAILARVILEFIQKYF 249
gi 26350411  169 TMESWESMNEVARRLMSSPELKDAKIPVEDRVYLVAQLAVVLKRIFVNLVWEYF 222
gi 655739201 197 TQESWEQLEEVLKELIRSPEVRNYTMPLEEQTGFAIRIMYMWKRFIVDMIKEFF 250
gi 350584118 196 SDKAKERGRDGVIDLGYDLLTAMAGsSGGPWGILISTSLKPVVKSGIHRVIQYY 249
gi 586547905 206 LEKAKERGQDGVIDLGYDLLMAMTGLSGGPMGLAISAALKPAMKAGVQRLIQYY 259
gi 831214190 196 TDESWVHLEEIGKRLMKDPEYKNFSMPTEDMLYFTMRIGIILKRIILDLIQHYF 249
gi 532100126 196 TDESWEHLEEIGKRLIKSPDIMDATLSTEDQIYFSVQIAILLKRIILDLLQKFF 249
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap