Conserved Protein Domain Family
CATSPERB

?
pfam15149: CATSPERB 
Cation channel sperm-associated protein subunit beta protein family
The function of this family of transmembrane proteins, CATSPERB, has not, as yet, been determined. However, it is thought to play a role in sperm hyperactivation by associating with CATSPER1. This family of proteins is found in eukaryotes. Proteins in this family are typically between 220 and 1107 amino acids in length.
Statistics
?
PSSM-Id: 317554
View PSSM: pfam15149
Aligned: 12 rows
Threshold Bit Score: 721.116
Threshold Setting Gi: 156406739
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158519875   569 FGNIHYGKVIHSGKTGRAYIRKVLQHTT-PKGFLSSVIAEMKEPFGLEEVNESSCLSSSLL-INKAG-NV-YKLTLDSQV 644
gi 156631020   569 FKTIHLGKTIEFSKTGLANIKNVYMHKTePVGFQTSIHTEIIVPFGIENSKDSPCLLSDLE-ITYSG-KLyYTIKLLSKN 646
gi 1019001848  595 FFSIHKGKLLTFSPSGSLVIEKVFQHDY-PPGYASSVFATIVEKIPVNTLKESPCLNSFLT-VSRNS-NStFTLTTQPND 671
gi 156406739   597 FDPTHVGQVIHSSYGGSAIIARLKKSVH-GSRFEGSVIAEVIEPF--QELQDD-VTNHPLS-VSFHGeNAtLKLA----- 666
gi 927163350   573 FNEIHFGKVIHSRKTGTAYIREILYHDT-PKGFLSSVIAEMIDPFGIEAVHESSCLSSSLS-INQAG-NFfYKLSLQLQT 649
gi 940768717   565 FSNIHLGKVINSKKTGNAYIRKLLQHNI-PEGFLSAVIAEIIEPFELEDVKESPCLSSSLS-INQDG-KF-YKLTLDLQS 640
gi 344273635   545 FNNIHSGKVIHHGKTGSAYIRKVLQHNN-LKGFLSSVITEIIDPFGIEEVRESSSLSSSLF-ITDVG-NFsYKLTLNLKN 621
gi 1022970345  521 FQNRHVGRRLQLKTTGFGEILKLMLHEE-VEGFPSSVMINLQSPFEIETPKLSPCLNSAIR-IERHA-NL-FKIILTSVQ 596
gi 532071165   446 FNNMHYEKLIQSSKSGKAHIRKILQHKT-PKGFLSSVIAETINAFELEDESESPCLSSSLL-IDKTS-NFtYKLTLTLQT 522
gi 1040210524  570 FKNIHYGKLIRSRKTGTAYIRKILQHEI-PTGFLSSVITEMIDPFGIEEVNESSCLSSSLY-INQSG-NFsYKLTLDPQN 646
gi 831221021   563 FSNIHNGKVIHSKKTGEAYINTVLNHDT-PKGFLTSVVAEMIQPFGLEEVTESSCLSSSLS-ITDHG-NSiYKLTLDSQV 639
gi 884922034   590 FNNMHFGKLIHSSKTGTAYIRKILQHKT-PKEFLSSVIAEVIQPFVVEEVNESSCLSSSLSiIEETG-NFtYKLTLDSQI 667
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158519875   645 --VQ--ALFEDTDIEKTVVLPGYSSFLITSILDNKNALAIATMPESAPNNMTFLKSTWFLYNFGQRN--GRTWKIYSKPC 718
gi 156631020   647 --PL--HELKSTDVEKSVLIPGYSSFLIMNITDKWTASALATMPQAIKSNLKFLTGSWFLYNFGTAG--GRKWSISTRQC 720
gi 1019001848  672 --SKlkSNFKVSDIEKTVVIPGYSSFLIFEIINNNSALAYATMPERIPLQ-TMPKDFWFIYDFGIKA--GRKWKISQDPC 746
gi 156406739   667 ---D--AEWRAEDKGRTIILPNGLSFIVLDEINSTTVIAVSHFHWTRGKGLQETYTGWTLYDFSSSKlaNTSWWLEEDVC 741
gi 927163350   650 sgDT--SSFQDSDIEKTVVIPGYSSFLITRILDNENALAIATMPGRVPNNMTFLKDSWFLYNFGQRN--GRTWKIYSKPC 725
gi 940768717   641 --VV--SSFQDSDIEKTVVIPGYSSFLITSIVDGNNALAMATMPERVPNNMTFVKDSWLLYDFGERN--GRKWEIYTKPC 714
gi 344273635   622 --VN--SSFRHWDLQKTVVIPGYSSFLITAILDDTNALAIATMPKRAPINMTFLENTWFLYNFGLSS--RRTWRIFSKRC 695
gi 1022970345  597 --VA--DQFLSSDIEKTVVIPGYSSLLIINILDVKNALALATMPEKVSLQQTIEPTKWILYNFGSTN--ATEWEIITPPC 670
gi 532071165   523 --AG--SLFKTSDIEKTVVIPGYSSFLITEILDPSNALALATMPQSVPLNMTFIRESWFLYNFGSVN--GRKWSVFSKPC 596
gi 1040210524  647 --AK--ALFQDTDIEKTVVIPGHSSFLITSILDGKNALAIATMPNRVPNNVTFLKDSWFLYNFGQRN--GRTWNIYSKPC 720
gi 831221021   640 --AN--ALFEDTDIEKTVMIPDYSSFLITDILDDKNALALATMPERAPVNNTFQKDTWFLYNFGQKN--RQTWTVYSKKC 713
gi 884922034   668 --VN--ALFNVTDIEKTVVIPGYSSFLITNILDDKNALAIATMPAIAPNNVTFLKGTWFLYNFGQKN--GRTWNIYSKPC 741
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158519875   719 NYWFQH-D-DSPSLNIVKYIDLGNSYVLKAKVIRn-aKGFRMLEIPLL----TVFVGNPNLLEVTAEVTFDDTDSYVITI 791
gi 156631020   721 NYWIQQdSlDFMSLNLVKYIDVGNTIDFQFKIIP---KAMSTFPIPPV----SMVVGNPGLVEVKTQGVFDLNENYYLDI 793
gi 1019001848  747 NYWFQH-K-NNQSLNVIKYVDLGKTKNFTFRTIPi-rQAISEFQMPLL----DVIVGNPTLLEVKTKQYWDDIDSYTMEI 819
gi 156406739   742 RSVLIS---SREGDAQFIHLDSRDNLSLVVSVIS----KVLSGEWPSVralpKLLIGNSKLFVVDSSYSLGHLNN-SLNL 813
gi 927163350   726 NYWFQQqD-GSLSLNVLKYIDLGKSHSFKIKVIPn-tKSVRTLEIPLL----KVIVGNPNLLEVKAKGYFDDTDSYLMEI 799
gi 940768717   715 NYLFQQdD-NTLSLNVLRYIDLGKSQTLGIKVIPh-gKGAHTLEVPLL----KVIVGNPNLLDVKVKGSFDNTDRYLMEI 788
gi 344273635   696 NYWFQQlD-KSLSLNILRYIDLGKYHTLSVKIIPh-aRGFQMLDVPPV----KVLVGNPSLLDVrAEGFFDDTGSYLLNI 769
gi 1022970345  671 KFMIMHnT-VHTSKSILKYLDVGSNLEFSIKVLTledTSIRRFKVPQI----KVMAGQPYLMDINTHAYWDETDSYTLDL 745
gi 532071165   597 NYWFQQsD-DSLSLNVVKYIDLGNSQVFKVKIIPn-sNRFQIIDYPLV----EVLVGNPMLLEVKVEGAFDDTNSYLVEI 670
gi 1040210524  721 NYWLQQsD-DSTSLNIVKYVDLGNSQNLEVKIIPn-tKGLRILETPLV----EVLVGDPTLLEVKAKGIFDDADSYIMEI 794
gi 831221021   714 NFWFQQ-D-DSLALNIVKYIDLGNSQILKVKVIPn-sESRKTPELPLL----KVLTGNPTLLEVKAQGTFDDTNSYLIRI 786
gi 884922034   742 HYLLQQlD-DSPTLSDVKYIDLGSSQTLQVKVIPn-kKSLKTLQVPTL----KVLVGNPKLLEIKVEGSFDDADSYLMKI 815
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158519875   792 SAASKVLHQGSTSLAFIMWSASTECFVTTMVPTLKSSCSYLRSMHHIPSKFIPFEDWISGVHKDSQGFNLIKTLPINYRP 871
gi 156631020   794 HVSGRFFQKGSTSIALVLWEGSSKCYAITLLPTIKSSCSYLRTMHHTPGRHIPPEDWISGVHKDSQGFNMIKTLPINYRP 873
gi 1019001848  820 YVKSKFLQKGSTSIAIVIWKASIECPVTTVILTLKSSCSYGKRMIFASHEKMMHPNSTMG--HESEYDTKMKKLPVNYRP 897
gi 156406739   814 FIKQRPQATGSSSLTVFIEESSLLCRSSSFTIAVHSGCPPSKMLHFIYPFTASEDALLASTVKDTLGVVRNKKLPYNYRP 893
gi 927163350   800 SAASKTLRQGSTSLAFIVWGASTECFVTTIVPTLKSSCSYLKSMHHIPSEFIPLEDWNSGVHVDSQGFNMIKVLPVNYRP 879
gi 940768717   789 SAASKTFLQGSTSLALIVWGASTDCFVTTFTPTLKSSCSYLKSMRHSPSTLISRDEWLEGVHPFSRDLNMIKTLPVNYRP 868
gi 344273635   770 TLSSKILRQGSSSLAFVVWEASTECFVTTFVPIVKTSCSYLRSMHHIPSKLIPLEDWISGIHKDDQGFNMIKTLPVNYRP 849
gi 1022970345  746 NIINRYLRKGVTSISFIVWQSTVLCETPIIVLTLKSSCSYSKYMNYVPKYEIKGEDWEFGQHKDERGFNMIKVLPINYRP 825
gi 532071165   671 SVTSRSLRQGSTSLALIAWAASTQCFVTTVVTTLKSSCSYLRAMQHVSNIIIPFEDWISGVHEDSQGFNMIKTLPVNYRP 750
gi 1040210524  795 SVVSRALRQGSTSLALVVWEAATECFVTTIVPTLKSSCSYLRAMRHIPSESIPVEDWIQGVHRDSQGFNMIKTLPVNYRP 874
gi 831221021   787 SASSKMLRQGSTSLAFIVWEASSDCFVTTVVPTLKSSCSYLKSMHHIPTRFIPLEDWNRGVHRDSQGFNLIKTLPINYRP 866
gi 884922034   816 SVSSKTFHQGSTSLALIIWGASTECFVTTLVPTLKSSCSYLTSMHHVPSQHIPKEDWISGVHKDSQGFNLIQTLPVNYRP 895
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158519875   872 PSNMGIAIPLTDNFYHADPSKPIPRNMFHMSKKTGKFKQCANVSTREECNCTKDQKFSHAVAFSDCREKVPRFKFPITQY 951
gi 156631020   874 PSHMGISIPLTDNFYHADPSKPIPRNQFHKSKETGKYKQCANVTSRAMCNCSEHQKFSHAVAFSDCKEKVHRFKFPVTQY 953
gi 1019001848  898 PSNLGIAIPLTDNIYNADPSKGRPRDYFPKSRLTGKYKQCANKTSRAECNCTENQKLSDNVAFSDCKEEVPRQKFPVVKY 977
gi 156406739   894 PSARGVGIPMTANVYHADPARPQYRDAFVVTRSTYRYKQCKGKAKRSHCGCTRATKVSSLVQHSDCIEVVYRLLFDEKLT 973
gi 927163350   880 PSNMGIAIPLTDNFYHADPSQPIPRNLFHKSKKSGKFKQCANASTREECNCTNNQKFSYAVGFSDCREKVPRFKFPVTQY 959
gi 940768717   869 PSNMGVAIPLTDNFYHADPSKPIPRNLFPKSRESGKFKQCANKSNRKQCNCTKDQKLSYAVAFSDCREKVPRFKFPVRQY 948
gi 344273635   850 PSKLGIAIPLTDNFYHADPSKPIPRNLFLMSKRTGKFKQCTNASTREECNCTNNQKFSHAVAFSDCREKVPRFKFPVTQY 929
gi 1022970345  826 PSNMGIAIPLTNNFYNADPSMPRPRNYHPLSKKSGIYKQCLNKTHREDCHCTEEMKKSENIVFSDCKEKVARFLYPVLQY 905
gi 532071165   751 PSNMGIAIPLTDNFYNADPSKPIPRNLFHKSKETGKYKQCARAASREECNCTNDQKFSHAVAFSDCKEKVPRFKFPVTQY 830
gi 1040210524  875 PSNMGIAIPLTDNFYHADPSQPIPRNLFHKSKEAGKYKQCANVSTREECNCTDAQKLSYAVAFSDCREKVPRFKFPVTQY 954
gi 831221021   867 PSNMGIAIPLTDNFYHADPSQPIPRNLFYKSKEAGKFKQCANASNREECNCTNYQKFSYAVAFSDCREKVPRFKFPVSQY 946
gi 884922034   896 PSIMGIAIPLTDNFYHADPSKPIPRNLFSKSKETGRYKQCANVSTREGCNCTDEQKFSYAVAFSDCKEKVPRFKFPVTQY 975
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158519875   952 PVSLEIINEDGRVPLQSPYLVTVTEVNMRHNWKLKHTVPENIKRMKQLVEPILGAAVYNPSGLNLSIKGSELFHFRV-TV 1030
gi 156631020   954 PVVLEIFNERDKISAEPPYLVTMTEVNMRKNWQLKHNEPENVKKMKHYLEPLLKTPVYNPLGLNLTIQGSELFHFKV-SV 1032
gi 1019001848  978 PIILGIVSEDGWIPLEPPYLITMTEVNNRETWKLKDNESLGVEKMKKYLKEENKLTVYNPKGLNLSIMGSELFHFRV-TT 1056
gi 156406739   974 PRFLVLREGREAETLTSPYY--LEELNNRSDFEIVNSSNKTVLQQAVVMEQAKNSSIY--------FYGSGLFHFRAfAV 1043
gi 927163350   960 PISLKIYNEDGYIPVETPYLVTVAEVNNRENWKLKQSVPENVKKLKDYLGLILHAPVYNPLGLNLSVKGSELFHFRV-SV 1038
gi 940768717   949 PVSLDVYSEDGHIPMETPYLVTVMEVNGRKHWEIKHTVPENVRRLKNYLESILHVPVYNPLGLNLSVKGSELFHFRV-SV 1027
gi 344273635   930 PISLQISTKKGNMPVGLPYLVTVTEVNMRENWKLKHSTPPTIRKLQSHLKSHLQVPVYNPIGLNLSIMGSELFHFKV-SV 1008
gi 1022970345  906 PILLHIKHDELSIPMDIPYLVTVSEVNNRKNWKLRHTVKNEMKRMKTHVESLFSDLVFNPNGLRLSITGSELFHFRV-KV 984
gi 532071165   831 PISLEIFSENERIPVKSPYLVTVTEVNMRKNWKLKHFVPQNVKKLKDHLEAVLRVPVYNPSGLNISIRGSELFHFRV-SV 909
gi 1040210524  955 PVSLKIFNESVLIPVKSPYLVTVTEVNLRKNWQLKHSVPVKIKKLKNYLEPLLHASVYNPLGLNLSIKGSELFHFRV-SV 1033
gi 831221021   947 PISLEIYNEDGRVPVKPPYLVTMTEVNKRKNWNLKQYLPENVKKMKNYLESIVQAPVYNPSGLNLSIKGSELFHFRV-TV 1025
gi 884922034   976 PISLEIFSDNKFVPVKFPYLVTVTEVNNRKNWQLKHSIPENMKKIKAYLEPILQSSVYNPSGLNLSIKGSELFHFRV-SI 1054
                          490       500       510       520       530
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 158519875  1031 ISGVTFCNLIEEFQIYVDEAPLPFPGHTLIAVATAVVLGGLIFIAFMFQLQGIHPW 1086
gi 156631020  1033 VPGVSFCELSEEFQIYVDEVPLPFPGHALIAVATSVVLGVLIFIAFVFQLRNIHPL 1088
gi 1019001848 1057 VPGVTFCPLVVEFQIYVDEVPIAFPGRSLIATTTAIFLGGFIFVTFLIKMYNIHAW 1112
gi 156406739  1044 QENYTFCDLEAEFLVFVDETPLPYPAKDIIRACTAM---GFFTLLYVLYLWNFHFR 1096
gi 927163350  1039 VPGVTFCNLVEEFQIYVDEAPLPFPGHTLIAVAAAVVLGGLIFIAFMFQIHNSHPY 1094
gi 940768717  1028 VPGVTFCNLVEEFQIYVDEVPLQFPGHTLIAIATAVVVVCLIYATFMFRIRTVSpg 1083
gi 344273635  1009 VPGVTFCNLVEEFQIYVDEAPLPFPGHTLIAIAAAIVLGGLIFVVFMFQLRNIHPW 1064
gi 1022970345  985 IPGVTFCNLVDEFQIYVDSAPLPFPGRVLVASLTAVVIGGIILMVFMVELFNVNIW 1040
gi 532071165   910 VPGVTFCNLVEEFQIYVDEVPLPFPGHTLIAVAAAVVLGGLIFTAFMLQLHNIHPW 965
gi 1040210524 1034 VPGVTFCDLVEEFQIYVDDAPLPFPGHTLIAVAAAVVLGGLIFTAFMFQLRDIHPW 1089
gi 831221021  1026 IPGVTFCNLVEEFQIYVDEAPLPFPGHTLIAVATAVILGGLIFIAFMLQLRDIHPW 1081
gi 884922034  1055 IPGVTFCNLVEEFQIYVDEVPLPFPGHSLIAVAAAFVLGGLIFSAFMLQLHNIHPW 1110
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap