Conserved Protein Domain Family
Neuropep_like

?
pfam15161: Neuropep_like 
Neuropeptide-like
This family contains putative neuropeptides.
Statistics
?
PSSM-Id: 317565
View PSSM: pfam15161
Aligned: 5 rows
Threshold Bit Score: 108.5
Threshold Setting Gi: 327507744
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 327507744  35 AEPAAGSAVPAQSRPCVDCHAFEFMQRALQDLRKTAYSLDARTESLLLQAERRALCACWPA 95
gi 543343585  30 ADQEAGTAIPAESRPCVDCHAFEFMQRALQDLKKTAYNLDTRTETLLLQVEKRNLCDCVAA 90
gi 551511531  27 ADQETGTVIPAESRPCVDCHAFEFMQRALQDLKKTAFNLDARTETLVLRAEQRALCGCMAT 87
gi 68363128   21 QAEDSGSVIPAESRPCVDCHAFEFMQRALQDLKKTAFNLDSRTENLVLRAEKRALCDCMPA 81
gi 823460274  43 G-QDPGSAIPAESRPCVDCHAFEFMQRALQDLKRTARGLDTRTETLLLRAEKRGLCDCFHA 102
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap