Conserved Protein Domain Family
DUF4580

?
pfam15162: DUF4580 
Domain of unknown function (DUF4580)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 63 and 185 amino acids in length.
Statistics
?
PSSM-Id: 317566
View PSSM: pfam15162
Aligned: 11 rows
Threshold Bit Score: 264.638
Threshold Setting Gi: 973133378
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156630466  10 VQWTTTIIISSSLKSYEIATALENRSHKVRYSDTLESGSIVFSLSGVAFLLMDAKECMTSAEE-IFVTKIEKFINIHQNS 88
gi 551511310   9 AQWRTTIIISSSLQNHDTCRTLSAQQHRIRFSDSVEAGAFIFPLSGTAFLLVDPQDLPEPLEEsGLTERIGKFVQVHRNC 88
gi 542223461   9 pQWKTTIIVSTSLQSHEIIRMLNAQQHRIRFSDSVHPGAFIFPLSGTAFLMVDPQDLPEPSEEsGVFERIKKFVQVHRNC 88
gi 597743164   2 SSWKTTVIVSTSLQNHEALWMILSQQHRLRFSDSVEHGALVFPLSGTAFMLITPEEFPEKSESsKFFNRIEKFVQVHRNS 81
gi 973133378   1 ----------mngKSHETALALSAQQHRVRYSDSVEEGTYIFPLSGIAFMIVDTQECADSPGVsRLFEKIGKFIQVHRNS 70
gi 637293024  10 MRWITTVIVSSSLQGHEISMSLQNQKHRIRYSDSVEDGCIIFSLSGVAFLLADAQGLFVTDRE-VFFERIKKFMSIHRNG 88
gi 525005439  10 TRWITTVIMSTALQDHEISTVLQRQQHRVRYSESVETGSVIFPLSGIAFILSDTQDLLKTGEE-EFSKRIHKFINIHRNS 88
gi 478621076  10 SKWSTTVIMSTGLQNHEISTILQRQQHRVRYSESVEIGSVIFSLSGVAFLLADIQDLLARGEE-QFLERIQKFINIHRNG 88
gi 755755618  10 IKWTTTIIISSSLKSCEVATALD-RSHKIRYSDSVENGSIIFSLSGVAFLLMDAKDCFTSAEE-IFLAKIEKFTNIHQNS 87
gi 556995915   9 AKWTTTVIISSTLRSHEVATSLISQQHRVRFSDTVEEGSIIFSLSGVAFIIVDVQKLFGNVEEaVLLAKLEKFMCIHRNS 88
gi 334321595  10 SKWTTTVIMSSSLQSHEVAAILKNENHRVRYSNSVEPGSIIFSLSGVAFLLIDAQECFRTTEE-TLLARIEKFIRIHRNS 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156630466  89 FLVLFAPLHGPEEWSLMFRIHQRFLGSNLRILPVHNTVNALDLMCTIAKTTSKPHIDSICYRMITTKAYIIEQSPVWRTL 168
gi 551511310  89 FLLLYSPFNGEKELQVLTVIQHRFIGSNLKILPVRNGAQIAKGMLTIAKATSKPHADKIRERMSLARAHIIETSPVWEML 168
gi 542223461  89 FLLLHSPFKGKKELETLTVIQNRFFGSNLRILPVQNTDEIVKGMLTIAKATSKPHVDSIRDRISLARAHIIESSPVWEML 168
gi 597743164  82 FLLLQSPVYGAREWEIVSTVQKRFFGSNLKVLPLHSNVDIVKALLTIAKATSKPLVDSIRERMALARAQIIERSPVWELL 161
gi 973133378  71 FLLFSSSLHAQREQEILFRIQQSFLGSKLRIIPVHNVAEMVKSMLTIAKATSKPHVDSVRDRMALARAQIIERSPVWDVL 150
gi 637293024  89 FLLLSAALHGPKEWDVMFKVQQRFLGSNLRIIPVHNTAEAIKLMLTIAKTTSKPHLDNIRYRMLMAKSQIVEQSPVWKML 168
gi 525005439  89 FLVLSAALYGPEEWSVMFRIQRRFLGSNLRVIPVHNPAEIVKLMLTMAKITSKSQADDTRCKMEMTKAQIMEKSPVWKML 168
gi 478621076  89 FLVLSAALHGPQEWNVMFRIQRRILGSNLRIIPVHNTAETVKLMLTIAKMNSKPRADDVSQKMAMTKTHIIENSPVWKML 168
gi 755755618  88 FLVLSAAFHGPEEWKLMFRIQQRFLGSNLRILPVHNTVDVINLMCTIAKMASKPYTDNICYRMVTTEAYIIEQSPVWKTL 167
gi 556995915  89 FLLLLAALHETREWETMIRIQQRFLGSNLRIIPVHNTNDIVKSILTIAKATCKPAVDNIWCRMVMATAQITDRSLVWEML 168
gi 334321595  89 FLALSSALHGPGEWRLMSRIQQRFLGDNLRIVPVHNPGNAVKLMTTIAKSTCKPYSDNIHYRMILAKAQIIEQSPVWRTL 168

                 ...
gi 156630466 169 QKI 171
gi 551511310 169 RDI 171
gi 542223461 169 RDM 171
gi 597743164 162 GHM 164
gi 973133378 151 SRL 153
gi 637293024 169 HQr 171
gi 525005439 169 QEy 171
gi 478621076 169 QEy 171
gi 755755618 168 QKL 170
gi 556995915 169 HKL 171
gi 334321595 169 QKL 171
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap