Conserved Protein Domain Family
DUF4564

?
pfam15169: DUF4564 
Domain of unknown function (DUF4564)
This family of proteins is functionally uncharacterized. This family of proteins is found in eukaryotes. This family includes the human protein C17orf62.
Statistics
?
PSSM-Id: 317571
View PSSM: pfam15169
Aligned: 15 rows
Threshold Bit Score: 204.866
Threshold Setting Gi: 74852543
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82183019    3 YMIVEKHTSELLHLKRSPGIRSWSILVGIASVGLAA-AYYSSDSI---LWKMFYVTGCFFVALQNMEEWEEAVFNKSKNE 78
gi 123885229   2 YMQVESRTGTLLHLKRNPSIRSWSLLVGISSVGLAA-AYYSTDTW---LWKLFYVAGCAFVALQNLEDWEEAIFDKKSGK 77
gi 74852543    1 -MRIVKTTSNELVLVHSNRLKEWSMGLAIASIGLLPtIFHTSDELfikMSKVVFIITFILIGLLGIHEEYYIEFNVKKRK 79
gi 557002039   2 YMTVENQTSSVLHLKRSPGIRSWSLLVGLSSVGVAA-AYYSSDSL---AWRLFYIAGCLFVAIQNMDEWEEAIFDKTKGK 77
gi 762101839   3 gVRVREETDEQLKLVKEPSLQSFGIVIAFMACGYGA-AVYSEDSS---LWKLVYVVSGLFVGLACIEDWEYCDFNRTTNE 78
gi 330805705   1 -MKIIKTTPNELVLISRNRLKEWSLAFAISSIGLLP-FLHQSDELfikAAKVVFFITFVLVGLLGIHEEYNIEFNIKKRK 78
gi 803124751   2 YMQVETRTSSRLHLKRAPGIRSWSLLVGILSIGLAA-AYYSGDSL---GWKLFYVTGCLFVAVQNLEDWEEAVFNKSTGK 77
gi 395537079   2 YMQVETRTGSLLHLKRSPGIRSWSLLVGILSIGLAA-AYYSGDNI---GWKFFYVTGCLFVAVQNLEDWEEALFDKTTGK 77
gi 50757685    2 YMLIETRTSSLLHLTRSPGIRSWSVFVGIASIGLAA-AYYSADSL---AWKLFYMAGCFFVAAQNLEQWEEAVFDKNKGT 77
gi 327264679   2 YMIVENHSKSVLHLKRSPSIRSWSLLVGISSVGLAA-AYYSEDSL---GWKLFYLAGCCFVAVQNLEEWEEAIFDKGAGK 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82183019   79 IELKTFSLYTMLLTLWKRGHEK-V-LLDLRHLRDVSVQEERVRYLGKGYLVVLRLATGFSYPLTQSATLGSRSDVEALAA 156
gi 123885229  78 AILITYSLYKKLLTLCKGGQEQ-V-VVLLKEIRDVNVEEERVRYFGSGYVIVLRFVTGISHPLTQSAVLGARSDVEAVAK 155
gi 74852543   80 MTME----YRNIIEVLTMQPGRnM-VLELDQIRGAVIQEIK--EKKPLYKLAIDYSDGLKIGVTETCYF-FPDQITEIKN 151
gi 557002039  78 VILKTINIYRRMLTMWQTGHEQ-V-VAELSHIRDVSVEEEKVRYFGKGYLVVLRFATGFSHPLTQSATLGGKSDVDAVAN 155
gi 762101839  79 LRQKRYTVYDKILHLFSTKNDQiV-VTSLSDIVDVEVEEQYVRYFGNTYQTVMVYDTGIRIGVTESFIYGNKSDQEAIAD 157
gi 330805705  79 VLME----YKNILELIARQEGR-VmVLDLDQVRSSSVQEVK-EGKKTLFKLVLDYSDGLKIGLTETYFY-YPDLIESIKT 151
gi 803124751  78 VVLKTFSLYRKLLTLCRAGHDQ-V-VVLLSDIRDVNVEEEKVRYFGKGYVVVLRFATGFSHPLTQSAVMGHRSDVEAVAK 155
gi 395537079  78 VILKTFNLYKKILMASRVCHEQ-V-VVGLNDIKDVNVIEEKVRYFGKGYTVVLRFATGFSHPLTQSAVMGHRSDVEVIAK 155
gi 50757685   78 VCLKTFNLYKKMLTFSKGGSEQ-V-VALLHEIRDVNVEEETVRYFGKGYLVVLRFVTGFSHPLTQSAVLGCRSDVEAVAK 155
gi 327264679  78 IFLKTFNLYKKLLTLSKAGHEQ-V-VVPLDEIRAVNVEEEKVRYFGKGYLVVLRFGTGFSHPLTQNAVMGCRSDVDALAK 155
                        170       180       190
                 ....*....|....*....|....*....|
gi 82183019  157 LLKRFLGLEELQQ---RLADDDYPDDDDGI 183
gi 123885229 156 ELTKFLEFDLVGSrpqAVEESNDSESDEAL 185
gi 74852543  152 SINKWLSDNGIIGn--NKNNKNNKNEEDED 179
gi 557002039 156 CITGFLGLDRDEKw-kDLSPSSDSEDGDQt 184
gi 762101839 158 KIRTFLRLGERPG---VVNGDTSSSSGDEE 184
gi 330805705 152 DINKWLTENNVVSn--KDKDLYGSddeddd 179
gi 803124751 156 LITAFLELHRLESp-vELSQSSDSEADGPG 184
gi 395537079 156 LIINFLELRQPESp-kDLSQSSDSDVDEPR 184
gi 50757685  156 LVISFLELDRAESq--DVYESSETEASDAD 183
gi 327264679 156 LITNFLELNKVPAy-qNFEDSSESDATDEE 184
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap