Conserved Protein Domain Family
CaM-KIIN

?
pfam15170: CaM-KIIN 
Calcium/calmodulin-dependent protein kinase II inhibitor
CaM-KIIN is the inhibitor of Calcium/calmodulin-dependent protein kinase II (CaMKII). CaMKII plays a central part in long-term potentiation, which underlies some forms of learning and memory. CaM-KIIN is a natural, specific inhibitor of CaMKII. This family is found in eukaryotes.
Statistics
?
PSSM-Id: 317572
View PSSM: pfam15170
Aligned: 7 rows
Threshold Bit Score: 128.785
Threshold Setting Gi: 731492430
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182627636   1 MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQI--GRAKRVVIEDDRIDDVLKGMGEKPPSG 78
gi 123885696   1 MSEILPYSDEKMGHYGSDGDVGQISFSCRLQDTSSFFGGNQQKRPPKLGQI--GRAKRVVIEDDRIDEVLKGVSDKSPSG 78
gi 190358746   1 MSEVLPYGDEKLSPYGDGGDVGQV-FSCRLQDTNNFFGAGQNKRPPKLGQI--GRSKRVVIEDDRIDDVLKNMTDKAPPG 77
gi 731492430  21 hvgVLPYGDEKLSPYDDCGDVGQI-FSCRLQDTTIFLSAGRTSRRPKLSQLsfSPFFTVVIEDDRIDDVLKNMTDKAPPG 99
gi 551492928   1 MSEVLPFNEEKMSHYGNEGDEEHLSFTCRLQDTNNFFNGSQNKRPPKLGQI--GRSKRVVIEDENGDEALKNGTEKTSge 78
gi 556980105   1 MSEILPFSEEKMSRYGAETEVSQISFSCRLQDTNTFYGGPQAKRPPKLGQI--GRAKRVVIEDDRIDDVLKGMTNKSSPG 78
gi 410924307   1 MSEVLPYSEGKMSGYGTDSEVSQMSFSCGLQDTSAFFAASQAKRPPKLGQI--GRAKRVVIEDDRIDDVLKGMTDKSSPG 78

                 .
gi 182627636  79 V 79
gi 123885696  79 V 79
gi 190358746  78 V 78
gi 731492430 100 V 100
gi 551492928  79 a 79
gi 556980105  79 V 79
gi 410924307  79 V 79
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap