Conserved Protein Domain Family
FAM180

?
pfam15173: FAM180 
FAM180 family
This family of proteins is found in eukaryotes. Proteins in this family are typically between 117 and 182 amino acids in length. There are two conserved sequence motifs: ELAS and DFE. The function of this family is unknown.
Statistics
?
PSSM-Id: 317575
View PSSM: pfam15173
Aligned: 15 rows
Threshold Bit Score: 162.077
Threshold Setting Gi: 884885162
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81874798   28 LFPAAHRPKRSlSLPLNPV-----LQTSLEEVELLYELLLAEIEISPDL-E-ISIKDEELASLRKALSFHSICNNIIPKR 100
gi 514748802  28 LYPAAQRLKRSsAAFLNPV-----LQNSLEDVVLLYEFLLAELDIDKSQ-R-ISIKDEELASLRKAAEFDTICNEIIPKS 100
gi 972984991  28 LYPSALRVKRGtVSLLNPT-----FQTSVEEVNMLYEILLHGLWMDNIYdH-FLIKDEELASLRKSKKLEVICEDVLPRK 101
gi 847110846  28 yFPSAHRIRRSsAELLNPV-----LQKSVPEVELLYEFLLSGVKLNRDQ-V-MTLQDPELSSLRKATTFHVICNDVIPKS 100
gi 432943704  28 LYPSAHRVKRGtHALLNPT-----FQLPGDDGNLLFEILLAGMHIQAET---LLIPDEELASMRRVEKLEVICEDVLPKK 99
gi 27734066   28 LFPAAHRPKRSlSLPLNPV-----LQTSLEEVELLYELLLAEIEISPDL-E-ISIKDEELASLRKALSFHSICNNIIPKR 100
gi 281340497  42 LLPGVTTTQHHpGQPMDSTsvgggLQEP-EAPEVMFELLWAGLEMDVMG-Q-LHIQDEELASTRPGRRLRLLLQHHVPSD 118
gi 395539469  28 LFPSAHRSKRSsSGPINPV-----LQNSlEEVELLYEFLLAELEISQDL-R-ISIKDEELSSLRKASDFNIICNEVIPKS 100
gi 483512397   6 LYPAAQRLKRSsAAFLNPV-----LQNSlEDVVLLYEFLLAELDIDKSQ-R-ISIKDEELASLRKAAEFDTICNEIIPKS 78
gi 348529146  27 LYPSAYRIKRGtYSLINPT-----FQHSvEDVKLLFEILLAGMQIQGDE-HtLLIPDEELASLRSVEKLEVICEEVLPKR 100
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 81874798  101 IPDIRRLSANLA--NHPGILKKEDFERITLTLAYTAYRTAL-SEGHQKDIWAQSLISLFQALRHDL 163
gi 514748802 101 ITEIRRLSSRLS--SYPRILKKEDFERTVLTMVYTAYRAAQ-SDGHQKDTWVESFVSLYKALKHDL 163
gi 972984991 102 ITEVRRLTSMLS--MHVGPLRKNDFERTVLTLVYTAHKLIQ-SKGHQKDMWAESFVKLYKALKQDL 164
gi 847110846 101 LSDIRRLGARLS--HAQGPLKRQDFERTLLTMAYTALKTPQsNTDHQQKIWLDSLTELFVALRRDL 164
gi 432943704 100 LSDIRRLIDDLT--RRRKRLSWPDFEKTVLTLVYVSQTAAQiTNRLQKEVWADALMKLFGAIRRDL 163
gi 27734066  101 IPDIRRLSANLA--NHPGILKKEDFERITLTLAYTAYRTAL-SEGHQKDIWAQSLISLFQALRHDL 163
gi 281340497 119 LEGAKQRLRQFQdlRKGPPLSPWDFEHLLLTGLSCVYRLHEaSEAEERGRWAQVFTLLAQETLWDL 184
gi 395539469 101 ITDIRRLSAHLS--ERIGVLKREDFERTVLTLAYTAYRTAL-AQGFQKDIWAQSLLSLFQALRHDL 163
gi 483512397  79 ITEIRRLSSRLS--SYPRILKKEDFERTVLTMVYTAYRAAQ-SDGHQKDTWVESFVSLYKALKHDL 141
gi 348529146 101 LSDIRRLTAELT--QRHQPLSWQDFERTVLTLVYTTQTLARiTNKHQKEMWTDTLIQLFQALQKDL 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap