Conserved Protein Domain Family
SMRP1

?
pfam15181: SMRP1 
Spermatid-specific manchette-related protein 1
This family of proteins, SMRP1, is thought to have a role in spermatogenesis and may be involved in differentiation or function of ciliated cells. This family of proteins is found in eukaryotes. Proteins in this family are typically approximately 260 amino acids in length.
Statistics
?
PSSM-Id: 317581
View PSSM: pfam15181
Aligned: 3 rows
Threshold Bit Score: 479.185
Threshold Setting Gi: 351699748
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 655599962   1 MFLFSRKTKTPISTYNDSYRAPTSIKEVYKDPPLWAWEANKFVTPGLTQTMERHVDPEALRKMVKCNNQDYTYKSSISGH 80
gi 655599964   1 MFLFSRKTKTPISTYNDSYRAPTSIKEVYKDPPLWAWEANKFVTPGLTQTMERHVDPEALRKMVKCNNQDYTYKSSISGH 80
gi 351699748   1 MFLFSNKTKTPISTYTDSYRAPTSIKEVYKDPPLWAWEANKFVTPGLTQTMKRHTDPEALQKMAKCATQDYSCKSSMSGH 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 655599962  81 PYLPEKYWLSQYE-DKCSPCYLSSDRYNTWRTAPYNSPYWNKYTTCLPRLPKDAGMETVARGMPLEYPPKPERLNAYERE 159
gi 655599964  81 PYLPEKYWLSQYE-DKCSPCYLSSDRYNTWRTAPYNSPYWNKYTTCLPRLPKDAGMETVARGMPLEYPPKPERLNAYERE 159
gi 351699748  81 PYLPEKYWLSQEEeNKCCPSYLGSDPYCTWRTRPYSSSYWNKYTTCLPRLPKEAGMETAVRGMPLECPPKPERLNAYERD 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 655599962 160 VVVNMLNSLSRNQQLPRVMPRCGCLDPLPGRLPYLGYESACSGRHYCLRGMDYCTGEAPYTE-RRLRPLCAEQPT----V 234
gi 655599964 160 VVVNMLNSLSRNQQLPRVMPRCGCLDPLPGRLPYLGYESACSGRHYCLRGMDYCTGEAPYTE-RRLRPLCAEQPT----G 234
gi 351699748 161 VVVNMLNSLSRNRTLPQITSRCGCVEPLPGRLPFQGYKSACSGRHYCLRGMDYCTPGPPCTErRHLRALCPEQPTvrvsQ 240
                        250
                 ....*....|....
gi 655599962 235 RAVSPYDHRPGMEC 248
gi 655599964 235 CVTLRPPARNGMCC 248
gi 351699748 241 CSSGAP-ARNALCC 253
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap