Conserved Protein Domain Family
OTOS

?
pfam15182: OTOS 
Otospiralin
This family of proteins, Otospiralin, has a role in maintaining the neurosensory epithelium of the inner ear. This family of proteins is found in eukaryotes. Proteins in this family are approximately 90 amino acids in length.
Statistics
?
PSSM-Id: 317582
View PSSM: pfam15182
Aligned: 6 rows
Threshold Bit Score: 125.327
Threshold Setting Gi: 620977547
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 402889853  46 AKPVQEEGDPYAELPAMPYWPFSTSDFWNYVQHFQALGAYPQIEDMARTFFAHFPLGSTLGFHVPYQED 114
gi 284172499  21 ARPVYGEEGPYEEAPAHPYWPYSTSDFWQYVEHFRSLGAYDKINDMARTFFAHYPIGDTLGYTSRNEDE 89
gi 597777501  22 ARYVP-EGVPYDEPPAVPYWPYSTSDFWNYIEYFRSIGAYNQINHMARAFYAHQHLGDTLGYEVPEHQE 89
gi 734643555  39 ARVIP-EGVPYDEPPAVPYWPYSTSDFWNYVEYFRSIGAYNHINEMARAFFAHQHLGDTLGYETNAGHe 106
gi 620977547  12 cmlmsaltDPFAEPPAMPYWPFSTTDFWSYVEYFRTLGAYQQINDMARTFFSHYPLGNTLGYNVPYHEh 80
gi 126314318  21 AKPVQEDGDPFAELPDLPYWPFSTTDFWNYFEYFQTLGAYHQINDLARTFFAHFPLGNTLGYNVPFQED 89
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap