Conserved Protein Domain Family
TEX13

?
pfam15186: TEX13 
Testis-expressed sequence 13 protein family
The function of this family of proteins has not, as yet, been determined. However, members are thought to be encoded for by spermatogonially-expressed, germ-cell-specific genes. This family of proteins is found in eukaryotes. Proteins in this family are typically between 177 and 384 amino acids in length. There are two conserved sequence motifs: FIN and LAL.
Statistics
?
PSSM-Id: 317584
View PSSM: pfam15186
Aligned: 44 rows
Threshold Bit Score: 189.34
Threshold Setting Gi: 0
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81873567     5 IDDPKSGFSHCEVVLFINEEVTQNGGGPGFYLTFHSRPWKDIEDGLKSVVVDTQVPRSIKRACAWSALALGVRVAMRQRE 84
41_pfamImport   1 LNDPACGFHQKEVVDFLNEQIIQNGVSPYFYVMHMFKSWGDMEMKLRDILNNPAISGGMKEACAWTSLTLAVWFAEKQKQ 80
6_pfamImport    1 FSDPTCGFFQREVVDFINKQILRNGVSPHFYSVQMCESWGDMEKKLRDILTNSAVAETTKEACAWKTLALAVGMAEKQRQ 80
18_pfamImport   1 FGDHESGFRHNEVIRFINNEILSNGGGPDFYLAFRSRPWNEVEDRLQAVLSDPQVPGHIKRACTWSALALSVRVAARQRE 80
8_pfamImport    1 PGDHASGFRHAEVISFINNEVLVNGGGPDFYVAFRSRPWNEIEDRLRTVVVDPQVPCTIKRACAWSALALGVRVAARQRE 80
32_pfamImport   1 FGDHASGFRHAEVVRFINNEVLLNGGGPEFYAALRSRPWSEVEDRLRGVLADPRVPRAHQRACAWSALALGVRGAARQRE 80
7_pfamImport    1 FGDHASGFRHMEAIRFINNKVLLNSGGPDFYVAFRSRPWNEVEDLLRSVLADLQVPRAIKRACTWSALALGVRAGARQRE 80
13_pfamImport   1 FGDHASGFRHNEVIRFINDEVLMNGGGPEFYVAFRSRSWNEVEDRLQAVVVDPQVPRALKRACAWSALALGVRAAARQRE 80
33_pfamImport   1 FGDHASGFRHNDVIRFINNEVLMNGGGPEFYIAFRSRPWSEVEDRLQTVVSDPQVPRTIKRACAWSALALSVRIVARQQE 80
35_pfamImport   1 FGDHSSGFHYNEVIRFINNEVLMNGGGPEFYVAFRSRPWNEVEERLQAIVSDPQVPRAVKRVCAWSALALSVRVVARLQE 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 81873567    85 KQLQRVQQLHDQVEEHEAATWTLATDLQRLRE----ERDEVVSELHNVKEHLKQVKFERDMLQRKIIE 148
41_pfamImport  81 EDEEKIKKLQDQVEEQKLLAGALLGAVSTLREkqekEKEKARSHRQQSLKVLRGVPEERNLLRS---- 144
6_pfamImport   81 EDREKVKKLQDQLDEQKLFTNVLVGTVNRLRNtqerEKEKARYQLQESVTALRGIEEERNLLRNELLK 148
18_pfamImport  81 QQMRRLRRLQDQLQEREGASWALASELQRLRE----AREEADSQLRFTQAALQQALSERDVLRGRLFQ 144
8_pfamImport   81 QQARRIRRLREWVEERETAAWALASELQRLRE----DREEAASQLRFTRAALHQALIERDVLRGRLHH 144
32_pfamImport  81 QQGRRIRRLQEQMEERETAAWALASELQRMRG----ERKEMAAQLRCARAALQQVSNERNVLRRRLIQ 144
7_pfamImport   81 QQARWVYGLQEQVEERETAAWALPSELRRLRG----ECKEVV---------LQQVLDERNVLRGRLLQ 135
13_pfamImport  81 QQAISLHQLLEQVEEREAASLALASELQRLRE----EREGVTAQLRYTQAALQQATDERDLMRWRLLQ 144
33_pfamImport  81 QQAYRVRRLQEQVEEWEAATWALVAELQQTRD----EREEMAAQLCFTQAALQQALNECDVLRGRLLQ 144
35_pfamImport  81 QQFRRVRWLQEQVEEREAATWAVASELQRLRD----EREEMAAQLRFTRAALQLAIEEREVLRGRLFQ 144
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap