Conserved Protein Domain Family
MEIOC

?
pfam15189: MEIOC 
Meiosis-specific coiled-coil domain-containing protein MEIOC
This family of proteins is found in eukaryotes. In humans, it is encoded for on the chromosomal position C17orf104.
Statistics
?
PSSM-Id: 317587
View PSSM: pfam15189
Aligned: 16 rows
Threshold Bit Score: 255.351
Threshold Setting Gi: 308497090
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 242003058  600 RSGPSSELHLRLEECYDQFKHLEKERKKTEAELARNNPGKKVS-SA-NNIPVP-RLPPNPSRVDRLIVDQSREHARVITL 676
gi 405967892  621 RSGPSNELHLKLEECYEQFRNIERERKKTEAELARQNPGKKVS-SA-NNIVVP-RLPSNPSRVDRLIVDSFKEHARIITL 697
gi 1043407920 467 RNVSSNELHVCLDKCYEQWREMQKERKQAEFILAANYTGKEVS-ST-NNTAIP-RLCANPSRVDRLIVDQLREHARVVTL 543
gi 1040684452 589 lgSPNSQLHFYLEECYEQWRMLEKERKRAEAILTKAYLGKLVS-MVvTSSSLP-KMPPNPSRVDRLIVDQLREQARVTGL 666
gi 675862150    1 RSGPSNELHLKLEESYEQFKCIENERKRTEAELARQNPGRNVS-SD-NNKVIPvQLSQNPSRVDRLVVETLKEHARVETL 78
gi 1039406157 579 QEGPAFQIHFYLDECYEQFRSLEKERKKAEVILKKAFPGKRAAvMT-NTNP-P-KTPPKSTRVDYLIVNQMKEQAKVASL 655
gi 339232606  319 RNDSLLDLHLSYDECFEEFRLLEKDRKKTEAELARHNLGKKIN-SS-NNIPIP-RLPVAPSRIDRMLVDYFREHARVVTL 395
gi 973187436  527 wcGPLGQLHLHFVECYEQQRLLEKERKKTENVLAGSYPGMRIS-AV-NSSSFP-NHLPNTLHIHNLIVDLLNEITEVIGL 603
gi 308497090  273 RYSFMAALQSKVDEVTDEYRQLEKERKQTEAELARHNLGKKIS-SS-NGLPIP-KLPTAPSRIDRMVVDFFREHARISTL 349
gi 343960000   24 RSGPASELHIRLEECCEQWRALEKERKKTELALAKNYPGKKVS-ST-NNTPVP-RLTSNPSRVDRLIVDELRELARVVTL 100
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 242003058  677 IAKMERLRGGKVNENIHTAMEAWLEAIKKVQCRRRDELINANNRHQDMMAgietyRVQEDKDILALAASIQDLSKASRKA 756
gi 405967892  698 VDKMEKLRDFVLHPHIHSALERWLEGIRKVQARRKEEIVNATNRHRNVGN-----RHQEDKDVLALAASIGELTTLCRKA 772
gi 1043407920 544 LGKMERLRSSPLHANISTALDRQLEAIHITQVRRKEEINNASNRQCQGES-----RCQEERDVIALASSVKNLSAATRKS 618
gi 1040684452 667 LGKMEQLRSFPLHANISSTLDRHLEVIYITQARRKEEFINASNRQRQPAA-----FFREDREILMLASAVKDLCISTRKA 741
gi 675862150   79 MLKMEQLREMNIPDGIYRSMNGWLEAVYNVQSCRKDEIINAINRHQLNNP-----QQQKEKDVLALASALDKLAHKIRSA 153
gi 1039406157 656 FDRMECLCGVPLHINIHAALKTHHMAICITQSRRKEDSGNMTKQQQQGI------NFTEDRDNPLMVMALKELAATTKRL 729
gi 339232606  396 LQKMEWLRSETLNSRVYEAVRAWFSAMRQLQTLRITERNNFIRNLT---------PIQEEIDVSNTANALKVLTKTVRRA 466
gi 973187436  604 LRKMEHLIGVPLHANINAALEEHLEVIDEAQQRM--ELIHSSNQQLKGPP-----RFREDNDILLLAAAVKNMGLATRKS 676
gi 308497090  350 LAKMEQLTGMSMPIAAHQTLAELLQAISSLYHSRVHERALILQQLRGEAI-----HYDEEKEAGVLVEILCLVQQAATRV 424
gi 343960000  101 LGKMERLRSSLLHASISTALDRHLESIHIVQSRRKDEIVNASNRQRQGVP-----RCQDDRDVFALASAIKEMCVATRKT 175
                         170
                  ....*....|....
gi 242003058  757 RTAMWCSLMVTLLK 770
gi 405967892  773 RTANWCALQMAdkd 786
gi 1043407920 619 RMALWCALQMTPSK 632
gi 1040684452 742 RTALWCALQMTLPK 755
gi 675862150  154 RTGLWCSLQLAsnd 167
gi 1039406157 730 RTALWCALQSTLPK 743
gi 339232606  467 RTAMACSLILTINV 480
gi 973187436  677 RTALWSALQMTLiq 690
gi 308497090  425 RAANWYCLMTTLGP 438
gi 343960000  176 RTALWCALQMTLPK 189
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap