Conserved Protein Domain Family
TMEM213

?
pfam15192: TMEM213 
TMEM213 family
This family of proteins is found in eukaryotes. Proteins in this family are typically between and 154 amino acids in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 317589
View PSSM: pfam15192
Aligned: 6 rows
Threshold Bit Score: 123.028
Threshold Setting Gi: 344297260
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 302393773   29 ASSSNSSSLTAHHPDpGTLEQCLNVDFCPQAARCCRTGVDEYGWIAAAVGWSLWFLTLILLCVDKLMKLTPDEPKDLQA 107
gi 620958735   31 APSNSSTAPTHIHLD-GNPAQCPGADFCIKVSRCCQLGVDEQGWVAAAVGWSLWFITLILLCVDKLVKLPADEPKDLQA 108
gi 1040129488  38 ASGGNSSAWTTQDPDpGSLEQCPSVDFCPQAARCCRAGVDEYGWVAAAVGWSLWFLTLILLCVGKLMKLTPEEPKDLRA 116
gi 395517522   61 AETHNSSSVPFPVSDsAFIAQCSDLDFCSKAAQCCKHGMDEDGWIAAAIGWSLWFLTLILLCVGKLRKITPEESKYTQA 139
gi 344297260   39 ANSSNSSAVTDPQPDpGTLEQCPTVDFCPLAAQCCHAGMDEYGWIAAAVGWSLLFLTLILLCVGKLMTLKPDDPKGLps 117
gi 50728904    28 AAGASNISTSTVHTD-EYEPPCLKVDFCTLAAVCCPTGVDDYGWIAAAVGWSLWFLTLILLCMEKVMKLRPDEPKYL-V 104
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap