Conserved Protein Domain Family
PLAC9

?
pfam15205: PLAC9 
Placenta-specific protein 9
This family of proteins was identified as being enriched in placenta.
Statistics
?
PSSM-Id: 317596
View PSSM: pfam15205
Aligned: 7 rows
Threshold Bit Score: 102.664
Threshold Setting Gi: 81900969
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 74742127   23 AePFSPprGDSAQSTACDRHMAVQRRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDG 96
gi 81900969   36 S-PSSP--GDLAGSPGCDRHAAVQRRLDIMEETVEKTVEHLEAEVTGLLGLLEELASNLPTGPFSPKPDLLGDD 106
gi 298104146  24 AePFIPsgGDPSRSTACDRYMAIHSRLNVIEETVEKTVEHLEAEVKGLLGQLEELAWNLPPGPFSPIPDLLGDG 97
gi 514468366  18 AePLSAsqGDPAWSTGCDRLVAVQSRLDVMEETVEKTTEHLEAQVKSLLGLLEELAWNLPAMPYSPAPDLL--E 89
gi 940762997   8 AdPSIPsrGDPARSTGCDTHVAVLGRLDVIEETVEKTVEHLEAEVKGLLSQLEGLAWNLPPGPFSPTPDLLGDd 81
gi 958664244  23 AePLIPshGDLARSPRCDRHLAVHSRLHVIEEMVEKTVEHLEAEVKGLLGQLEELAWNLPPGPFNLTPDLFGED 96
gi 301774080  11 AePSVSsrGDPTWNAGCDRYMAVHDRLDVIEETVEKTVEHLEAEVKGLLGQLEELAWSLPPGPLGPIPDLFGDD 84
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap