Conserved Protein Domain Family
STIL_N

?
pfam15253: STIL_N 
SCL-interrupting locus protein N-terminus
Statistics
?
PSSM-Id: 317635
View PSSM: pfam15253
Aligned: 15 rows
Threshold Bit Score: 635.544
Threshold Setting Gi: 156363514
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158931148   47 LWDPSANGEVVSLHFSYYRNPRLFLVEKALRLAHRHARQTNKPRFFCFLLGTLAVDSDEEGVTITLDRFDPGREQT-GCL 125
gi 514779719   13 LWDPAPMGEAVGSHIAYYRNPKLFLMEKTLRLAYRHAKQSEKKLFACFLLGTLAVDEDGEGIKLTIDRFDPGREVA-GGS 91
gi 973134524   47 LWDPSLCGEVTSLHLSYYRNPRLLVVEKALRLAHRHARQSDG-SFFCFLLGSMMVDDDEEGITLTLDRFDPGRQLQ-GSP 124
gi 597756871   47 LWDPTPNGDLVHVHLSLYRNPRLLLLEKALRLAHRHARQSKMLQFSCFFIGTLAVDGDEEGVTLTLDRFDPGREQP-GCP 125
gi 768956969   46 LWDGSPVGEKLFLQLLSNRNLRLVLLEKALRLAQRHVRRSDKPSVQCFFLGSVLVDSDEEGVTVTLDRFDPGRDQP-SSS 124
gi 432855859   45 LWDGTPAGEKLNLQLCSHRKLHLVLQEKTLRLAQRHARHSNKPSLHFFLLGSVSVDADEEGITVTLDRFDPGRDQG-GGS 123
gi 542203856   40 LWDSSPVGEKLRLHLSSHRKPRLVLLEKTLRLAHRHARRSNKPRLHCFLLGTVSVDSDEEGITITLDRFDPGRDQA-GAS 118
gi 148222539   46 LWDTAPMGDGIGLHVSYYRNpRLLVSEKALRLSYRHAKTGRKP-FSCFLLGTFsvdeDEEGVTLIIDRFDPGREKTgGGG 124
gi 565318679   13 LWNPAPIGESTVSHIS-YRNPKVIIAEKTLRLAHRHAKQSRKKPFTCFLVGTLAVDENGERVLLTVDRFDPGREEP-NGL 90
gi 902884316   13 LWDPVPMGDTMGSHIAYYRNPKLFLMEKTLRLAYRHAKQSEKKLFACFLLGTLAVDEDGEGIKLTIDRFDPGREVA-GGS 91
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158931148  126 GKAPTALLPGDILVPCVFEAQHAA--SSTVHSSEDLNISFKMLQHFCCSKELLELSKLLTLRAQLSCSENMDRLTFNLSW 203
gi 514779719   92 GKVPTASLPGDFLIRCTVNAWGPSsgSIIVHSAEDISLAFKDLQHSLCSKDSLDLSKLLTVRAHIVFTENLDNLNFSFHW 171
gi 973134524  125 GKVPTALLPGDFVVPCTISTQGPAlpDTVVHSAEDFNIAFKMLQHWCSSREPLDPSKLLTMRAHLVCAENMDSLCFRLHW 204
gi 597756871  126 GKAPTALLPGDVLVPCLFEAQPVa--ESTVYSADDFDVSFKMLQHCCSSRETLELSKLLGLRARLSCLENMDRLSFGLNW 203
gi 768956969  125 GRVPCAMLPGDVLVPCLYLTHGDt--SDAVQSESDLHHCFKSLQQLLSGRQNLELGQLLKVRGRIICSQQSDATLFSLSW 202
gi 432855859  124 GPVPSTVLPGDVAVPCLFSDRPEpmpEAVIHSETEFHQCFKVLQHAVSCRQTLDLSQLLKIRARIICSHQSDAAVFSLSW 203
gi 542203856  119 GQVPSAPLPGDVLVPCLFSSQt----ETVVQSEAELHHCFKVLQQFVSSRQTLDLSQLLKVKGHVACCEQIDAATFTLSW 194
gi 148222539  125 GKVPTAQLPGDFVLPCTI-TLGKgsnNVIVHTPEDFTSSFMSLESHLHSKEALDLSKLLTMRAHITYTENMDNLHFDLRW 203
gi 565318679   91 GKIPTAPLPGDFFIPCRIGASECssnDTIVHTFEDFNLAFKILHQNLNSQDSLELSKLLTLRVHISSVENMDNLNFDFHW 170
gi 902884316   92 GKVPTASLPGDFLIRCTVNAWGPssdSIIVHSAEDISLAFKDLQHSLCSKDSLDLSKLLTIRAHIVFTENLDNLNFSFHW 171
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158931148  204 AAVTLACTLDAVPIRAVPIIPTALARNLSSPAGVTQ-----NSKRGFLTMDQTRKLLLILESDPKAYTLPLVGIWLSGVT 278
gi 514779719  172 ASITAANILEYTPVKSVPIIPTALARNLNGPMNIAQvq--gTYKCGYLTMDQTRKLLLLLESDPKAYALPLVGVWLSGVT 249
gi 973134524  205 AAVTVANTLDATPIRPVPIIPTALARNLTSPMGLTQvq--sTCKFGFLTMDQTRKLLLLLESDPKAYTLPLVGIWLSGVT 282
gi 597756871  204 AGLTLANSLEAVPVRAVPIIPTALARNLSSPVSIAQplhsaGRKRGFLTMDQTRKLLLVLESDPKVYTLPLVGVWLSGVT 283
gi 768956969  203 SSVCPSVGLDVQAVRAVPIIPTALLRSLTSTARPLPql--aNCQKGYLTMDQTRKLLLLLESDPKACSLPLVGLWLSGVT 280
gi 432855859  204 LAVCPAMSVDIQPVRPLPIIPTALLRSLTGAGRPAQh---sSHQRGFLTMDQTRKLVLLLESDPKASSLPLVGLWMSGIT 280
gi 542203856  195 SIISPSVSVEVEPVRSVPIIPTALFRSLTNVSRPLGhe--sSRQRGFLTMDQTRKLLLLLESDPKASSLPLVGLWLSGVT 272
gi 148222539  204 AAVVVANTFESTPIKPVPIIPTALARNLGSHNNIAQlq--gTHKSGYLTMDQTRKLLLVLESDPKVYMLPLVGIWLSGVT 281
gi 565318679  171 AAVTVANVLKCTPVKPISIIPTALARNLSSNMSIAHiq--gTYKYGYLSMDQTRKLLLILESDPKACTLPLIGIWLSGLV 248
gi 902884316  172 ASITAANILEYTPVKSVPIIPTALARNLNGPMNIAQvq--gTYKCGYLTMDQTRKLLLLLESDPKAYALPLVGVWLSGVT 249
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158931148  279 HIHNPLVWAWCLRYLHSSSLQDKVLSEGGTFLVVLYSLTHRDPEFYQCKPSTGQQQ--LSFQLLTSRDSLTLYKNVEPSE 356
gi 514779719  250 HISSPQVWACCLRYLFSSSIQERVFSESGRFLVVLYSLTHKDPEFYECVPCRGQTE--LGFQLLTCNETVHLFKNVEPSD 327
gi 973134524  283 NVQSPQVWVCCLRYLFSSSLHDRVMSEGGGFLVVLYTSTHRYPEFYQCHQYNGQKE--LNFQLLKSTEFVNLYKDVEPSE 360
gi 597756871  284 HIHNPLVWAWCLRYLYSSSLQDRVMSENDAFLVVLYSLTHREPEFYQCKLRGGMMD--MSFHLLTSTETVTLYkNVEPSE 361
gi 768956969  281 HVSSPHVWVWCLQFLFNSSLQDRVFSDGDYFLLVLFCSTHKSPQFYKCGRSGLGPGprLDYKLLTASQCVTLY-QVGAVE 359
gi 432855859  281 HVYNPQVWVCSLRFMFGASLQDRVLSESGCFLLVVFGSTHRAPQFFQCRGSRTGPQ--LECQILTSTQSVTLYqQVVPAD 358
gi 542203856  273 HIYNPQVWAWCLRFMFSSTLQDRVLSDGGSFLLVVFGCARRAPQFFRC--RGSGPQ--LDCQLLTASHTATLYqQALQVD 348
gi 148222539  282 HIHSPQVWAACLRYIFSSSIHERVLSESGSFLIVLYSLTHKEPEFYECCPCVRHDP--LGFQLLTCQDALHLFkSAEVSK 359
gi 565318679  249 HIHNPQVWAFCLRYLYSSSIQERVFSETGRFLVVLFALNHKDPKFYECLPYDGRTE--LDFQLLTCKETLHLFkEVEPSD 326
gi 902884316  250 HIGSPQVWACCLRYLFSSSIQERVFSESGRFLVVLYSLTHKDPEFYECVPCRGQTE--LGFQLLTCSETVHLFkSVEPSD 327
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158931148  357 GRPLQFELSSENQNQETVLFEEVLSQSVLTGttlGAASAAP-QnKLSISDHDSGVEDEDLSPRPSPNPHPVSQQTKRVHP 435
gi 514779719  328 KIPIQFELSAENQNAETEFFSRICKKLPIRS---PPHGCSP-S-KLSASDHDSGVEDEDLSPRPIPSPHPVSQQVTKIFP 402
gi 973134524  361 GRPLQFELSAESQNKEREFFKEVASQVSFPS---SSTSSP--KmKLSTSDHDSGVEDEDLSPRPSPSPHPVSQQLHRIHP 435
gi 597756871  362 GRSLLFELGTDHQSREAELFKEVLSRSAQPRntrAASSATA-QnKLSSSDHDSGVEDEDLSPRPSPNPHPVSQQARQVHP 440
gi 768956969  360 GQAVHCELSSEGDSRQMDVFRMAQLSFN----------SSHaAaGVCASDQDSGVEDEDVSPRPSPSPHLPTQQVRRVQP 429
gi 432855859  359 GRVLRCELGSEVHSRQAEVFRAAQRSFS---------SSPPpAaGLSVSDQDSGVEDEDLSPRPSPNPHLPAPQTRRVQP 429
gi 542203856  349 GKTLQVELTSEDHSRKLEVFREAQISFS---------RAPPpAaALSVTDQDSGVEDDDLSPWPSPSPHTPAHQARRVEP 419
gi 148222539  360 NPLLQFELSNECQEFEANLFNETCKNKSI-----TV----PlSnKLSTSDHDSGVEDEDFSPRPSPRPHPSVQQVSRIHP 430
gi 565318679  327 KYPIQFELNSENINAETEFFRKISKNISINS---LSLDCSPn--KLSVSDHDSGVED-DASPRPFPRPHPINQPMTEIRP 400
gi 902884316  328 KIPIQFELSAENQNAETEFFSRICKKLPIRS---PPHSCSPs--KLSASDHDSGVEDEDLSPRPIPSPHPVSQQVTRIFP 402
                         410
                  ....*....|...
gi 158931148  436 LVPELSMVLDGSF 448
gi 514779719  403 SVPELSLVLDGSF 415
gi 973134524  436 SVPELSLVLDGNF 448
gi 597756871  441 SVPELSMVADGSF 453
gi 768956969  430 SVPELSLLVDNSF 442
gi 432855859  430 SVPELSLLVDGSF 442
gi 542203856  420 SVPELSLLIDSSF 432
gi 148222539  431 SVPELSLVFNSFF 443
gi 565318679  401 SVPELSIVLEGIs 413
gi 902884316  403 SVPELSLVLDGSF 415
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap