Conserved Protein Domain Family
CCDC14

?
pfam15254: CCDC14 
Coiled-coil domain-containing protein 14
This protein family, Coiled-coil domain-containing protein 14 (CCDC14) is a domain of unknown function. This family of proteins is found in eukaryotes. Proteins in this family are typically between 301 and 912 amino acids in length.
Statistics
?
PSSM-Id: 317636
View PSSM: pfam15254
Aligned: 13 rows
Threshold Bit Score: 1039.37
Threshold Setting Gi: 973148505
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439420    96 DSESQTDTL-Q-GLDGCASLLRDILKNEDS--GSEM---VY------SENRCNSKPLEGRKNRSKKKGPEKHV-PSVVRK 161
gi 998706603    47 ESDNQVDTI-QnGLDHCAALLKNILQKEAT--GRET---VNkqpgktATCKFTSKPFLTKGNTSKKKGLKRIItPAPVQK 120
gi 637247572    51 DSEDQVANI-HhGLDRCAALLKDILQNDSE--GMET---VCrkagkaAVVRTTGKPLLSKVSSLKKRGPKKKTlSANVQK 124
gi 532108430    49 DSESQTETI-Q-GLDGCASLLRDILRNEDS--ASET---AY------SENRCNSRPLEGKKCGSKKKGHEKHIfPSVVWK 115
gi 344240305    48 DSESQPEIV-Q-GLDGCTSLLRDILKNEDP--GPEI---VY------SENRCNARPLESKNCRAKKKGPGKHA-PPVVRK 113
gi 655854412    97 DSESQTETV-Q-GLDGCASLLRDIMRNEDS--GTET---AY------SENRYNSRTLEGKRCGSKKKGQDKHTiP-LVQK 162
gi 940743443    97 DSESQTESV-Q-GLDGCASLLRNILRNEDS--GSEI---VY------SENRCNPRPLEGKRHGSKKKGHENHTvPSLVRK 163
gi 528936644    97 DSESQTETV-Q-GLDGCASLLRDILRNEDS--GSEI---TY------SENRCNPRPVETKRYRSKKKGHEKHTvPSVVRK 163
gi 973148505    70 DSEDQVTTIhK-GLDRCAALLQGILQKEKA--DVKP---ANskpgraAASKPQSKVTFGKGVNGKRKQQRRTVpIPQVQK 143
gi 874467544   169 DSDDQVDSIhN-GLDRCAALLKNILQNEATgrETNHkqpGk-----tTSVKFTSKPLLTKASTSNKKGLKKNItAAHVRK 242
gi 1020984779      --------------------------------------------------------------------------------
gi 821472573    19 DSDEQVGAVpQ-GLERCRSLFQDIVQNE------ET---TYgnpgkgSSGKLGSRPWEYKGNKPKKKGLPKNVvPSCVRK 88
gi 530375143    97 DSESQAETV-H-GLDGCASLLRDILRNEDS--GSET---AY------LENRSNSRPLESKRYGSKKKRHEKHTiPLVVQK 163
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439420   162 E------I-------------LSSENRKWISNEASTG-----S----DT--AQRWSLQDHYRMYSPIIYQALCEHVQTQM 211
gi 998706603   121 E------I-------------VPILNRKIASSTTLPIekelsS----AAenQMVQSIHVPCNEHSPEVYQKLYEHVQTQM 177
gi 637247572   125 E------I-------------LPVSTRKTFSGNVNAVgkdvaPlsseQA--LSVQPVCMPCTQHSPVMHQKLCEQIQTQM 183
gi 532108430   116 E------T-------------LSSDNKKQILNEASAGserdtS----SI--AQDWSLQDHYRMYSPIIYQALCEHVQTQM 170
gi 344240305   114 E------I-------------LSSENKKWISNEASTGnekdkS----DI--AQHWSLQDHYRMYSPIIYQALCEHVQTQM 168
gi 655854412   163 E------M-------------LSSNNKKQIPNEASAGskrntS----DI--PQNWSLQDHYRTYSPIIYQALCEHVQTQM 217
gi 940743443   164 E------I-------------LSSDYKKQIPNETSAGnerdsS----AI--PQNWSFQDHYRMYSPIIYQALCEHVQTQM 218
gi 528936644   164 E------I-------------LSSDKKKQIPNDASVGserdsS----DI--LQNWSLQDHCGMYSPLIYQALCEHVQTQM 218
gi 973148505   144 AaaaaapV-------------VKSSLYPGLEDNRCLSicnnaV----QA--PVAQPVLVPIAQGSLEAQLGLSEDVQTQM 204
gi 874467544   243 E------IvqisnkklapstgPSTEKELSSAQQ-NQLvqpihV----PC--S----------QQSPVMHQKLCEHVQTQM 299
gi 1020984779    1 ----------------------------------------------------MVQSIPVPCSEHSPEAYQKLFEHVQTQM 28
gi 821472573    89 E------I-------------LSSGHKKPPANIASPEnekdpS----ST--KQIQPNQVPFNFDFSTMYKSFCEHVQTQM 143
gi 530375143   164 E------T-------------SSSDNKKQIPNEASARserdtS----DL--EQNWSLQDHYRMYSPIIYQALCEHVQTQM 218
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439420   212 SLMNSLALKN------------GpNGIHAV-CH--TMSNSG-S-QATPHSGFGCSPSASVWPPQQPSCPLMVHSEVQTDA 274
gi 998706603   178 SLITGQPTQK------------S-NEIPAVtPC--PTSNQG-C-QNVTALNYQLPTSTSALSLQHSANPLSTHSGGPVES 240
gi 637247572   184 SLLNMQLPQK------------SnNNITEApFS--IIPEKGtS-QPVTAFNSRLPSSTPALSPQHAANPTVVQPGVSVNS 248
gi 532108430   171 SMMSNLASKN------------CsNGIPATpCH--TESGSE-Y-QATSRSSYGCSTSTPAWSPQRLPCPPVVHSEVQTDD 234
gi 344240305   169 SLMNALTSKN------------ApNGMPTA-CH--TVSGLE-S-HATPPSGYGCYTSTSVWSPQQPSCPLMVHSEVQTDS 231
gi 655854412   218 SLMNNLASKN------------StKGIPAVpCH--TVSGSE-S-QATSQSNYGLCTSIPVWSAQQPPCPSVVHAEVQTCG 281
gi 940743443   219 SLMNNLASKK------------NpNGIPAVpCH--IVSGSE-C-QATPRSSYGLSTSTPVQLPQPPPCPPVVHSEVQTDG 282
gi 528936644   219 SLMNNLASKN------------NpNGIPAApCH--TVSGSE-S-QTSSPSSYGLPTSIPVRVPRQPPCPPMVHSEVQTDG 282
gi 973148505   205 SLLSCPVPG---------------NSIPTQpAHkgP--------QTATVFNSRLTTSTPTLSPPHSGNPFYIQTNLSNDM 261
gi 874467544   300 SLVTDQPPQN------------S-NQIPAVt----PTSDHG-Y-QNVTAFNYRLPTSTADLSLQCAANPLSTQSDVLVSS 360
gi 1020984779   29 SLITGQPSQR------------S-NEIPTVaP---PTSNQG-C-QNVTALNYQLPTSTSALSLQHSANPLSTQSGVPVDS 90
gi 821472573   144 SLINAQSSQSvsdsgppvfnygIpTSTPVLsPH--ATQPSD-VqS----------------------------------- 185
gi 530375143   219 SLMNDLTSKN------------IpNGIPAVpCH--APSHSE-S-QATPHSSYGLCTSTPVWSLQRPPCPPKVHSEVQTDG 282
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439420   275 DNQFESQSQATSVKYG-DV-P------R--------D--------PFSVHPGVACGLPH--ADSPAVAKSRQLDLTSCIL 328
gi 998706603   241 ANECVPEMGGPVVCPV-VSaAaaaaaqT--------Q--------SGTAPPAVIPCTAPg-ASTPSMPALIPTSSAREIA 302
gi 637247572   249 CDQCAAQMGPTLLMAT-TSdS------TsipqmkpsT--------SCSALPHIFASAA----SDPTSSTFPSSAPSKEAT 309
gi 532108430   235 DNQSASQSKIISVNHS-DG-P------R--------N--------SFNISPGVPCGLPq--tDKAAIPTFQQPSLANWIL 288
gi 344240305   232 DNHLGSQDQTSSVNLP-DV-P------R--------N--------SVSVHPGILCGLSh--iDKAAVPTPQQLSLANWIL 285
gi 655854412   282 DNQFTSQGRTVSVNCS-GV-P------R--------N--------SLNTSPALPRSLPl--tDRSALPTFQQLGLANGIL 335
gi 940743443   283 DNQFASQHNPISVNCT-DI-L------R--------N--------SFSSSLGVQCSLPq--tDKPTIPAFEQLDLANEIL 336
gi 528936644   283 DSQFASQGRTTSVNCTdDV-V------R--------N--------SFNTCLGVSCNLPq--tGKPATPTFQQLGLANGVL 337
gi 973148505   262 NCQVTSQGGVAHFLQQmRP-V------T--------Avst---vqPVSLPLLVQPLTApaetVAQSIPQPPCNSETGGVG 323
gi 874467544   361 GNECMAQMKGTVAFPVvSN-S------T--------Tpq----tqSASALPGVMPCIAsgvsHNSTVPTFTPSSVGREMT 421
gi 1020984779   91 ANECVPETGGPVVCPVaSA-A------P--------Aaq----iqSGTALLGVIPCAApg-aSTPLVPT-----SARDMA 145
gi 821472573   186 ETQAPQQSGAVSLTSTnAP-G------Q--------TiitnlphtSCLPTSGE---------NNPAAPVVQPLVHNNGIL 241
gi 530375143   283 NSQFASQGKTVSATCT-DV-L------R--------N--------SFNTSPGVPCSLPk--tDISAIPTLQQLGLVNGIL 336
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439420   329 PQQ----RAPKEAELLKCFQThtsLFPAHGKDALSDSQA------YQSPSQLQPAFLATNEEKCAKEQFEEATNEGKHls 398
gi 998706603   303 PSQe---QQMKEADVMWCIQA---LLQSSEILNGRPEQR------GHHHCPAKHDGSCDTEEDTSEEHSEDMVSEEDE-- 368
gi 637247572   310 SKPgnqdQWFKEADLIKCIQShlaVLQAHENKNGKANEKlqdvekCQGVDQMQPKPFIARDEDDAEEYGESTPSEEEd-- 387
gi 532108430   289 TQQ----GVPKEADLLKCFQThmsLFQSHEKETLPDSQT------HRSSTQSQLAFLATNEERCAREQIGEATNEGKyln 358
gi 344240305   286 PQQ----RAPKAADLLKCFQThmsL-PAHGKDALSDSQA------HQSPTQLQPAFLATNEEKRAREQIGSATSEGKyls 354
gi 655854412   336 PQQ----GVPKEADLLKCFQTymsLFQSHGKETHPDNQT------YQSPTRSQQAFLASSEDKDAREQIGESTSEGKdln 405
gi 940743443   337 PQQ----EVLKEPDLLKCFQTymnLLHSQ-----PDRQT------NRSPTLLLPTSSATNEENCAKEQIGEVTTEGKdsn 401
gi 528936644   338 PKR-----LSEEPDLLKCFQTymkLLRSH-----PDSPT------RRSPTLLQPAFLATHEEKCTNKHIGEVRSEGKdln 401
gi 973148505   324 QSPh---ESLKDQALLRQIHMhleHRQQEPSTQHVASQA-----------PHQGQNLLSRE---TSEDSEGTTSDEDg-- 384
gi 874467544   422 PSHe---QQRKEADLIRCIQAhlsLLQSHEMTNGRTDQKhc--nhCPAPQNVS----INREEDAFEE-----LSEEDd-- 485
gi 1020984779  146 PSQe---QQIKAADLMRWIQA---LLQSHEMLNGRTEHRdh--hhCPEKHDGS----CDTEEDTPEEDSEDTVSEDE--- 210
gi 821472573   242 AAQgiseQLGKEINLLKCIQAsldLLHPHGVKAHEKHQN---------SDSVEQSTILATEDEYSSVPIWESLSDDEita 312
gi 530375143   337 PQQ----GIHKETDLLKCIQTylsLFRSHGKETHLDSQT------HRSPTQSQPAFLATNEEKCAREQIREATSERKdln 406
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439420   399 THVQDAKIAKN--------------VQQAENVSQTAEKIRLAKCLLGELKALM--EEDSEVQRLVTEVEACVSGLSAVSG 462
gi 998706603   369 LTVLDMSPVKDtsckts--yvrkvlKSRKESPEETAHKVRTIKHLMGELRALVidQGDSEMLRLMSEIEDSVSLLPAVVG 446
gi 637247572   388 LNGVDIAPVRDtscqts--fdkealKLKRSNLQKTAQKIKTLKYLLGELKTLLtdHDDSEMLRLLSEVEDTVSLLPAVAG 465
gi 532108430   359 IHVQDTKTVKD--------------VQKAKNVNQTADKVRTIKYLLRELKALVaeQEDSEIQRLITEVEACICGLPAVSG 424
gi 344240305   355 MHVQDAKIAKN--------------VQQAENVSHTAEKVRIAKCLLGELKALVaeQEDSEVERLITEVEACISGLSAVSG 420
gi 655854412   406 IHKQDAKMVKD--------------VQKAKNVNQTAEKVTTIKYFLGELKALVaeQEDSEIQRLITEVEACVSELPAVSG 471
gi 940743443   402 MHVRDSR-IKG--------------VQKAKNGNESAEKIRTIKYLLGELKALVaeQEDSEIQRLITELEACISLLPATSG 466
gi 528936644   402 IPLGDSR-IKD--------------VQKAKNVNQSAEKVRTIKYLLGELKALVaeQEDSEIQRVITELEMCISLLPAVSA 466
gi 973148505   385 LDCVDITPVKDtscqtsfekpklssRTKKMSPEQTAKKVKTVKYLLGELKALVadQDDSEVLRLISEVEESISLLPVMVG 464
gi 874467544   486 LNVLDVAPVRDtscqrs--fvrkdlKQRQESPEKTAHKVKTVKYLLGELRALItdQDDSEMLRLMNEIEDCISLLPAVVG 563
gi 1020984779  211 LNVLDVSPVKDtsckts--hvkkvlKSRKESPEETAHKVRIVKYLMAELRALVtdQGDSEMLRLMSEVEGSVSQLPAVVG 288
gi 821472573   313 MQAPNSAKCIQ--------------KAKSASPEELSPRMRTLKYLLGELKALVaeQGDSEIQRLIREVGECISLLPEVAE 378
gi 530375143   407 IHVRDTKTVKD--------------VQKAKNVNKTAEKVRIIKYLLGELKALVaeQEDSEIQRLITEMEACISVLPTVSG 472
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439420   463 HPNVEVEIALALQPLRSENAQLRRQLRILNQRLREQEKTEKGPG----NLELFSLQSLNMSLQNQLQESLKSQELLQSKN 538
gi 998706603   447 STNIQAEIALALQPLRSENAQLRRRLRILNQQLREQESSEKTSGqs-cSYELVSLQSLNMMLQSQLKESQKGLDSLQAKN 525
gi 637247572   466 NTNVQAEIALALQPLRSENAQLRRRLRILNQQLKDQGKAKECNld--cNFELISLRSLNMTLQAQLNESSKSIESLQNKN 543
gi 532108430   425 NRNIQVEIALAMQPLRSENAQLRRQLRILNQRLREQENTQKTSgpvecNHELYSLQSLNTSLQNQLQESLKSQELLQSKN 504
gi 344240305   421 HTNIEVEIALALQPLRSENAQLRRQLRILNQRFRE-EKTPKTPg----NLELLSLQSLNVSLQNQLQESLKSQELLQSKN 495
gi 655854412   472 NTNIQVEIALAMQPLRSENAHLRRQLRILNQRLREQEKTKKTTgsvecNLELFSLQSLNMSLQSQLQESLKNQELLQSKN 551
gi 940743443   467 NKNTQVEIALAMQPLRSENAQLRRQLRILNQQLREQGKTKKAYgsqecNLELFSLQSLNKSLQNQLQESLKSQELLQSKN 546
gi 528936644   467 NTNIQVEIALAMQPLRSENAHLRRQLRILNQQLREREKTQKASgslecSLELSSLQSLNKSLQNQLQESLKSQELLQSKN 546
gi 973148505   465 STNIQAEIALALQPLRSENAQLRRRLRIVNQQLKERERAEKESrssdcNFEIISLQSMNMALQSKLQESQKGFEALQKRN 544
gi 874467544   564 STNVQTEIALALQPLRSENAQLRRRLRILNQQLRERERNEKTSgq-scNYELVSLQSLNMMLQTQLKESLKGLESLQAKN 642
gi 1020984779  289 STNLQAEIALALQPLRSENAQLRRRLRMLNQRLREQESSEKTSgh-scNYELVSLQSLNMMLQSQLKESQKGLDSLQAKN 367
gi 821472573   379 NTKMEGEIALAMQTLRSENTHLRRRLKAISQRLREQEKMMKSSdsldyNFELISTQSLNMSLQTQLKESLRNQKLLKSKN 458
gi 530375143   473 NTDIQVEIALAMQPLRSENAQLRRQLRILNQQLREQQKTQKPSgavdcNLELFSLQSLNMSLQNQLEESLKSQELLQSKN 552
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439420   539 EELLKVIENQKEENKKFTTLFKDKEQTLLHNKQQFDIEMTRVKMELEEALANEKNLRFKLETAEKESQILGITLRQRDAE 618
gi 998706603   526 EELLKIIESQKEENKHLGKSIQDKEEELLENKQHYDIHSTKLKIEVEEALGTVKSLQFKLEASEKENKILGITLRQRDAE 605
gi 637247572   544 EELIKILETQKEESKRLTRIIHERDQELLEKRQQSDIESTKLKLEADEALTNMKHFQYKLEAADKENQILGITLRQRDAE 623
gi 532108430   505 EELLKVIENQKDENKKFASIFKDKEQTLLENKQQFDIEITRIKIELEEALVNVKNSRFKLETTEKENQILGITLRQRDAE 584
gi 344240305   496 EELLKVIENQRDENKKFTTMFKDKEQTLLQNKQQFDIEMTRVKIELEEALANEKNFRFKLETAEKENQILGITLRQRDAE 575
gi 655854412   552 EELLKVIENQKDENKKYTSIFKEKDQTILENKQQFDIEITKIKIELEEALVDVKSSKFKLDTAEKENQILGITLRQRDAE 631
gi 940743443   547 EELLKVIENQKDENKRFAGIFKEKDETILENKQQFDIETTRIKIELEEALVNEKSCQFKLEAAEKENQILGITLRQRDAE 626
gi 528936644   547 EELLKVIENQKDENKKFAGIFKEKDQTLLENKQQFDIETTRMKIELEEALVNMKSSRFKLEAAEKENQILGITLRQRDAE 626
gi 973148505   545 EELVQIIEDQRQEKSLLLKTIEDKDKELQQRRQTCEVDTARVKMDVDEALSQMKSFQFKLEASEKENHVLAVSLQQRDAE 624
gi 874467544   643 EELLKIIENQKEENKHLAKDIQDKEKELLENKQQYDIHSTKLKIEVEEALANVKSLQFNLEASEKENKILGITLRQRDAE 722
gi 1020984779  368 EELLKIIESQKEENKHLAKGIQEKEEELLENKQHYDIHSTKLKIEVEEALGTVKSLQFKLEASEKENKILGITLRQRDAE 447
gi 821472573   459 DKLLKVVENQREEYKKYVKLFQEKDKKLFENKKHFEMEIAKIKIELEEALANVKTYQFKLETSRKENKILDVTLNQREAE 538
gi 530375143   553 EELLKVIENQKDENKKFSSIFKDKDQTILENKQQYDIEITRIKIELEEALVNVKSSQFKLETAEKENQILGITLRQRDAE 632
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439420   619 VARLRELTRTLQSSMAKLLSDLSMDTARCRMGNSLTKSLLNVYDQQLQQDPAPA--QTSIMSYLNKLETN-HSF-IHSKL 694
gi 998706603   606 VKRLRELTRTLQGSMAKLLSDLTGDSVRPKPEKALSKSLLEDHEKQMQPELFPG--STSVMTYLKTLEMD-HIL-IDTDL 681
gi 637247572   624 VNRLRELTRALRGSMSKLLADLTMDTAKPKQERSLSKAVLEIHEKQMQPEAYAL--SDSIMNYLKKLEID-PVL-MEAEA 699
gi 532108430   585 VTRLRELTRTLQNSMAKLLSDLSMDTACCKPGNNLTKSILNIYDKQLQQDPVPP--HTSIMSYLNKLETN-HIF-THLEP 660
gi 344240305   576 VARLRELTRTLQSSMAKLLSDLSMDASRSKLGSNLTKSLLNIYDQQLHQDPTPL--HTSIMSYLNKLETN-HSF-AHSEL 651
gi 655854412   632 VARLRELTRTLQNSMAKLLSDLSVDSARCKSGNNLTKSLLNIYDRQLQHDPAPA--HTSIMSYLNKLETN-HSV-AHLEP 707
gi 940743443   627 VTRLRDLTRTLQSSMAKLLSDLSMDTARSKPGNNLTKSLLNIYEKQPQHDPISA--QTSIMSYLNKLQTD-RTF-THSEP 702
gi 528936644   627 VTRLRELTRTLQSSMAKLLSDLSMDTARYKPGNNLTKSLLNIYEKQHQHDPISA--HTSIMSYLSKLEPD-HTLiTHPEP 703
gi 973148505   625 ISRLRELTRSLQGRMARLVSELNLEKNVPKTSTHLTKTLLDCYDYQQKASSASDsvSNAINMYLKTLEANqHCFlQEGMP 704
gi 874467544   723 VNRLRELTRTLQCSMAKLLSDLTADNIKPRSEKGLSKSLLEDYEKRMQPDPFPG--SSSVMTYLKKLEMD-HIL-TDTEL 798
gi 1020984779  448 VKRLRELTRTLQGSMAKLLSDLTGDNVRPKPEKALSKSLLEDHEKQMQPELFPG--STSVITYLKTLEMD-HIL-IDKDL 523
gi 821472573   539 ITRLKELTRTLQNNMAQLLTDLSVDHVLYKPEKIFTRSLLNIHEKHLQHKQSPP--QFS-MGYLKKLEND-QIF-TRSES 613
gi 530375143   633 VTRLRELTRTLQTSMAKLLSDLSVDSARCKPGNNLTKSLLNIHDKQLQHDPAPA--HTSIMSYLNKLETN-YSF-THSEP 708
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439420   695 LN----NEAAIEPDRLCESVLPp-----QRPPHSDAGTADGGSASGTVSAASVEDSDMDCETLTVIED--------GCNV 757
gi 998706603   682 QFpn-kTGEVEMQNLSYEKFAA------EGSKINSTFTEERTSAPKGPPAPLKQDAETGSDSGTLLDD--------QTKL 746
gi 637247572   700 LFp---kAEMKESNQIDVTRAA------EYSSQKCPVAEEEIVAPRNVFTFLKPSIESTDGSNTLVE---------GTGL 761
gi 532108430   661 VSai-kNEKTIEKN-PYENVLPs-----KVPPHSDIGGMERVLAPEILSTLSKQDSDAECETMTLIEd--------ECNL 725
gi 344240305   652 LT----NEEATEPPRLCEKVLPs-----QGPPHSDTRAVGGGFAPGMASAALVEDSDTECETIALIEd--------ECNV 714
gi 655854412   708 LSti-kNEETTEPDRPYENVLPs-----KGPQPRNTSGREEEPASGIISALSKQDSDAENETLTVIEd--------ECNL 773
gi 940743443   703 LSai-nNAENIVPDRPYENVLPs-----KSPQHSNTRKMEEVSAPGIISTLSKQDSDEESEIPTLTEg--------ECNL 768
gi 528936644   704 VSti-dSEENMVPDRPYENVLPs-----KGPQHSNTRSMEEVSAPGIIPALSKRESDEESEITTLVEd--------EHNL 769
gi 973148505   705 TFceskENGGLSTWRIGDSFGNp----------------EENSSPM-----------KACMTTPLTEnglslgsnrEAEL 757
gi 874467544   799 QSsn-kNGELQMLNLAYETFAA------EENNINHIFSEERTSASRILPTLLKQDADTVSDSGTLIDe--------QSKL 863
gi 1020984779  524 QFpn-kTGEVEMQNLPYEKFAA------EGSKINSMFTEERTSAPRGSPAPLKQDAETGSDSGTLLDd--------QTKL 588
gi 821472573   614 PFlk-eDRKRGVPDVSYENFLNpelckhKSPGSANELDLE------TSPYHSKVLSEVESETDTLIDd--------ESRL 678
gi 530375143   709 LSti-kNEETIEPDKTYENVLSs-----RGPQNSNTRGMEEASAPGIISALSKQDSDEGSETMALIEd--------EHNL 774
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439420   758 -DSTVYIPFARNTSKKHSPLCKRLSPQPKLSVAAAQLVSGSAQ-TSKGES------------KPRAPa-----vCSS--- 815
gi 998706603   747 -DETIYIPLTSSASKKQQSVSGRSSLLPQSRGACQRLDYHCEFpSSVQQYgcedp---alldKLNAG-------YSV--- 812
gi 637247572   762 -DETIYIPLSSSPSQNPAAATERRIDTHH--QVPKKL--NSDLaNSQQANrfgmigngkvsdKLYSs-------YCP--- 826
gi 532108430   726 -DSTIYIPFARSPSKKNLPLSKRVSPQPQisVATRQLvsDSAL-ISETEN------------KLCVPv-----vCSS--- 783
gi 344240305   715 -DNTLYIPFARSTSKKHSPLSERLSPQPMrsVATTQLasGNAL-ASKREH------------SPCAPl-----vCSS--- 772
gi 655854412   774 -DSTVYIPFVRSTSKMNSPLSKRLSPQPQmsVAITQLvgNSGL-VSETEK------------KLCAHav----tCSS--- 832
gi 940743443   769 -DNTIYIPFARSPSKRKS-LSTRVSPQPQisVAPRQLlsKGGP-VSEKEN------------KSCAPg-----vCSA--- 825
gi 528936644   770 -DKTIYIPFARSTPKKKSPLSKRLSPQAQisVAPPQPv--sGL-VAEKEK------------KLCAPg-----vCSS--- 825
gi 973148505   758 -DKTTYIPLKETVRKQQYSSDAPMMPSAHcsSNKKPYdsKRNPsDDIVQCvkpkhl-dcafeKLHISkg----pLSY--- 828
gi 874467544   864 -DETVYIPLTSSASKKQVV-LGRTDGLHHtrGACKMLdfNCDLsNSLQQNrcetskdptildKLSTG-------YSV--- 931
gi 1020984779  589 -DETIYIPLTSSASKKQQPDSGRSGVLSQsrGGCQRLdyHCELpSSVQQYgcedp---slldKLNAG-------QSV--- 654
gi 821472573   679 nDETIYLPFAISSSKKKST-PERKSPLPQnnVS--KLsgNNGIpGSEKQN------------ELLKPtslfvssEDAkas 743
gi 530375143   775 -DNTIYIPFARSTPEKKSPLSKRLSPQPQirAATTQLvsNSGLaVSGKEN------------KLCTPvi----cSSS--- 834
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439420   816 ----------RNEAEDAPGDLSSTYDTEDVQLLRKIKEAIGKIPAA----A-----------------------EHAKEQ 858
gi 998706603   813 ----------KNSVENTLEVTGDKAKPEGDKVQVRPRGIPSGAAKDfmdkP-----------------------DQPQPG 859
gi 637247572   827 ----------KKSVENKAETAERIAMLEGRRLQMPPKETTSEAAKVisdnP-----------------------DRLHPD 873
gi 532108430   784 ----------KNETEDAPEKLSRTTDTEDKQLLKKIKEAIGKIPVA----A-----------------------EDPEEQ 826
gi 344240305   773 ----------RNEAEDAPGNLSRASDTEDMQLLRRIKEAIDKIPAS----AgdaagaagaagaagaagaagagtEHPKEQ 838
gi 655854412   833 ----------RQEVEDAHEKLSRTADTEDKQLLKKIKEAIGKIPVA----R-----------------------EDPE-- 873
gi 940743443   826 ----------KKEAEDAPEKLSRTAEMEDKQLLKKIKEAIGKIPAA----I-----------------------EEPQDG 868
gi 528936644   826 ----------CQK-EDAPDKLCRTADLEDKQLLKKIKEAICKIPPA----P-----------------------EE--ES 865
gi 973148505   829 ----------RGDSLQSPGKSSNTPSSDTDGALLRPLGRTDTVAGG----N----------------------------S 866
gi 874467544   932 ----------KKSMENTLEVTGDKVKL-GDKVQVKPKGAPSGVAKD----Ctd-------------------kpGQIQT- 976
gi 1020984779  655 ----------KKTVENTLEVTGDKAKPEGDKVQVRPRGIASGAAKD----Fmd-------------------kpDQPQPD 701
gi 821472573   744 fekfpntsslKRETEVASEKI-RAVNVEDEQLLMKIKEVISKIPN-----------------------------DFMDKS 793
gi 530375143   835 ----------TKEAEDAPEKLSRASDMKDTQLLKKIKEAIGKIPAA----T-----------------------KEPEEQ 877
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439420   859 ATHHGPSAHPSP--GVPVKGSIVPDSSFLNSDL---MSDWSISSFSTFTSHDEQDFRNGLAALDANIARLQKSLKTGLLE 933
gi 998706603   860 TYPRTSMPFPTG--ISQKTGSKAADFSCISFDDfsgRSDWSASSFSTFTSRDEEDFKNSLAALDANIARLQRTLQSNIRK 937
gi 637247572   874 KFLYAPVAHQKGniHNKDVGISAPDSSFSTFDWmsgKSEWTVSSFSTFTSRDEENFKHGLAALDANIARLQKTLQNSLKK 953
gi 532108430   827 AACPGLSACHST--NVQVKSNVVCDGSFLNSDL---MSDWSISSFSTFTSRDEQDFRNGLAALDANIARLQKSLRTGLlE 901
gi 344240305   839 ATHHGPSACQSS--GVPVTGNIVSDVSFLNSDL---MSDWSISSFSTFTSHDEQDFRNGLAALDANIARLQKSLRTGLlE 913
gi 655854412   874 ATCQGPSACHKS--SIRVKGSTACDGSVLNSDL---MSDWSISSFSTFTSLDEQDFRNGLAALDANIARLQKSLRSGLlE 948
gi 940743443   869 AACH-----------VQVKSSAVSDGSFLNSDL---TSDWSFSSFSTFTSRDEQDFRNGLAALDANIARLQESLRFGLlE 934
gi 528936644   866 AACHGPSACQNS--NVQVKSSAVSDGSFLNSEL---TSNWSISSLSTFTSRDEQDFRNGLAALDANIARLQKSLRTGLlQ 940
gi 973148505   867 NHFQHFVPCDENrgQVFNRRSSTFNSTFSSFDIrsvASDGSMSSVSTFNTRDEQEFRNGLAALDASIASLQKTIQSDL-- 944
gi 874467544   977 ---HVPMPFQKE--FPKKRGNEATDTSFISFDDisgRSEWSASSFSTFTSRDEEDFKNGLAALDANIARLQRTLQNTImK 1051
gi 1020984779  702 TYPHASEPFPAG--ISEKTGGKAADFSCISFDDfsgRSDWSTSSFSTFTSRDEEDFKNSLAALDANIAKLQRTLQSNIrK 779
gi 821472573   794 SVHHHTLACQTA--TSMLKNSTLCDYSFLNSDLmsrMSDWSVSSLSSFTSRDEQDFRNDLAALDANITRLQKTLQTGLlK 871
gi 530375143   878 TACHGPSGCLSN--SLQVKGNTVCDGSVFTSDL---MSDWSISSFSTFTSRDEQDFRNGLAALDANIARLQKSLRTGLlE 952

                   .
gi 296439420   934 K 934
gi 998706603   938 Q 938
gi 637247572   954 t 954
gi 532108430   902 K 902
gi 344240305   914 K 914
gi 655854412   949 K 949
gi 940743443   935 K 935
gi 528936644   941 K 941
gi 973148505   945 K 945
gi 874467544  1052 Q 1052
gi 1020984779  780 Q 780
gi 821472573   872 K 872
gi 530375143   953 K 953
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap