Conserved Protein Domain Family
DUF4590

?
pfam15257: DUF4590 
Domain of unknown function (DUF4590)
This family of proteins remains to be characterized and is a domain of unknown function. This domain family is found in eukaryotes, and is approximately 120 amino acids in length. There are two conserved sequence motifs: CCE and PCY. In humans, the gene encoding this protein lies in the position, chromosome 1 open reading frame 173.
Statistics
?
PSSM-Id: 317639
View PSSM: pfam15257
Aligned: 17 rows
Threshold Bit Score: 146.715
Threshold Setting Gi: 514682727
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 675880896   193 SNSWMVRRDEVVVEQQHCGGSTITVFKDKLCPGSDFTFVSTRHSDYPFSLTIYVDYKQNTRVSVCCEAKH---RKGVRLG 269
gi 823475052    89 hvSLRDWKDEIKVYQQYCGTENICVYKGDLLEGDTFQFISKRYLGFPFSLTFFLNGLQVDRLSCCCEYRGfqcKRPSQLR 168
gi 780181427   298 QYEREDKRDEIQIYQQHCGGENLVVFQGFADKGNDLIFVSRRHRGYPFSVTFFVNRVQVLRLSACCEYKY---TPGALLG 374
gi 762135874   336 prDQYDPTQNISIDQQHCGGNTLTVFKENLKPGDTFSFISRRHRGFPFSLSIFMDGRVDCRVSTCCEYKH---AKGVKLG 412
gi 761906506   223 lMSVFDPRVYVEVHQQHCGGNNICLFKGKLLAKDQFTVTSKRHYGMPFGMSLYVNGLINCRISSCCEYKH---KQGQVLG 299
gi 313224625   277 DTAFLDLED-VVVEQQHCGGENIKVFQRNLKRGEKFKFVSRRHRGYPFSFVVYVNSIRVERISACCEYRY---KKGSKLG 352
gi 1020985029  313 G-----YKDEVKVYQQYCGTENICVYKGELMEGDTFQFVSKRHLGFPFSLTFVLNGTEAERLSSCCEYRH---LRRGSGS 384
gi 971408889   339 SHDDSDYRDEIKVYQQHCGGENLCVYKGKLLEGETFQFVSKRHRGFPFSLTFFLNGMQVDRLSSCCEYRH---QKRSRLG 415
gi 637318653   245 SYELFDYREEIKIYQQHCGGENLCVFRGKLLEGETFHFISRRHYGFPFSLTFYLNGIQVDRVSSCCEYKH---RKGTRLG 321
gi 941761275   289 SDHPSILRDEIKVLQQHCGGENLCVYQGKLCEGDVFQFLSRRHKGFSFSLTFYQNGLLVERLSSCCEYKH---SKGSRIG 365
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*.
gi 675880896   270 G--NSGMFGIVSVR--------------NPRFCEKCsetRKRRKLE 299
gi 823475052   169 R--KNTYFRVLHVA--------------GAPPCYRC---FLAMGLD 195
gi 780181427   375 G--SKGHFKFKGVQ--------------GSSPCYKC---LVEAELA 401
gi 762135874   413 G--KMGHFSLLKVE--------------GATPCYKC---KLtskas 439
gi 761906506   300 GgkSSANFRLLKVE--------------GGQPCYLC---KFGHANQ 328
gi 313224625   353 C----GTIRLMSVK--------------GAAPCYACn--IRNNNLK 378
gi 1020985029  385 R--SGNRSGN---RsgsrnsyfrvlhvaGAPPCYRC---IVAMGLD 422
gi 971408889   416 G--RHGYFGFLNVE--------------GASPCYRC---IVAMGLD 442
gi 637318653   322 G--KHGHFGFVNVE--------------RSAPCYRC---IISMGLD 348
gi 941761275   366 G--RHGLFGFCSME--------------GASPCYKC---ILAMSMD 392
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap