Conserved Protein Domain Family
PP1_bind

?
pfam15276: PP1_bind 
Protein phosphatase 1 binding
This domain contains a protein phosphatase 1 (PP1) binding site.
Statistics
?
PSSM-Id: 317652
View PSSM: pfam15276
Aligned: 15 rows
Threshold Bit Score: 75.4032
Threshold Setting Gi: 765151822
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 313224616  187 KRRVTFGNRLSPEIFDYRKPPDTPIRKGTTPAKKSNERKSILRDTPMRKpLVAlrEESMTVPKL 250
gi 972948919  359 KKRVRFGLPLSPEFFDKRLPPNTPLQKGGTPAPASPSTGSRLRPVLKKTpLRL--PALLPELDF 420
gi 672078322  225 RKRVTFGEDLSPEVFDESLPANTPLCKGGTPVHPRNVSITTSPL--QSP---V--HEQFLQPNF 281
gi 395842527  390 RKRVTFGEDLSPEVFDESLPANTPLRKGGTPICKKDPSDTDSQPPEMSL---V--PEILPQPNF 448
gi 947263785  398 RKRVTFGEDLSPEVFDESLPANTPLRKGGTPVCKKDCGRASPLQLEQAP---V--SEPLSQPNF 456
gi 982933960  238 RKRVTFGEDLSPEVFDESLPANTPLRKGQTPVRKKDLSSLSPPLLEQSP---V--PEWLPQPNF 296
gi 528478658  249 KKRVRFGAPLSPEFFDKALPPSTPLQKGGTP--RCPPSSTGPKRSLLKTpQRC--EPSLPQPDF 308
gi 565313499  377 RKRVSFGGQLSPELFDKRLPPNSPLKKGAIPARLSMPFGNSPRAVLKKA-EEL--SQSVIQGSF 437
gi 847112389  198 RKRVSFGGHLSPELFDKRLPPNSPLKRGATPARRS-LSLVTPLALMRKSfGGF--RQTAIKETF 258
gi 363742084  328 KKKVTFGDDLSPEIFDKTLPANTPLRKGSTPVCRSGSERDSPFIRAGLT------EEPLTQPNF 385
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap