Conserved Protein Domain Family
Consortin_C

?
pfam15281: Consortin_C 
Consortin C-terminus
Consortin is a trans-Golgi network cargo receptor involved in targeting connexins to the plasma membrane.
Statistics
?
PSSM-Id: 317656
View PSSM: pfam15281
Aligned: 17 rows
Threshold Bit Score: 151.717
Threshold Setting Gi: 551525680
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82078238  285 EMFPSNGLVSILKKRICI--------KEVGDSEKDSSKRKVRFREPDNTFEQEESARASCLILLLMCVVTVVVSLGGTAL 356
gi 597762930 275 EMFPPNGLVSILKRRAGLee----ddSANCSPSRSSDKRKVRFRETDD--DNDEVGGASCLIFLLLCLVTVVISMGGTAL 348
gi 768935020 512 EIFPPCGLVSILKRQNETvd----caPMNFRSSKASSKRCVRFKLPDDSYEHDVGGGDSCLVLFLLCLVTVMISLGGTAL 587
gi 679216874 289 EIAPAEGLVSILKKRDDRe------gKTIAQAQQRQTKRRVRFQEMEDTLDQDEVAGGSCILLILLCIATVFLSIGGTAL 362
gi 565314677 296 ETVPAEGLVSILKKRDDSe------eKRLAQIQLKQSKRRVRFQEMEETLEQEDVGAGSCILLILLCIVTVFLSIGGTAL 369
gi 637257071 583 ETVPTEGLVSILKKRDDTe------gKTLAQIQTRQSKRRVRFQEMDDTLDQEEVGGGSCILLILLCIATVFLSIGGTAL 656
gi 542244123 718 EVSPASGLVSILKKRKVCiddvsassSSDPPPEKPTAKRRVRFKVPDDHYEPDVGSGDSCLLLFLLCLVTVFISVGGTAL 797
gi 551525680 174 gssSPDGLVSILKRRRASldgl-pppSPATTADKQTSKRKVRFSEPEDGVDQDDVGGDSCLILLLLCLVTVVISIGGTAF 252
gi 941764128 664 EMSPAAGLVSILKKQSVYvdslttsaDPEPARDKPTAKRRVRFKVSDDTFDHEVGGGDSCLLLFLLCLVTVVISVGGTAL 743
gi 768935018 672 eIFPPCGLVSILKRQNETvdca----pmnfRSSKASSKRCVRFKLPDDSYEHDVGGGDSCLVLFLLCLVTVMISLGGTAL 747
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 82078238  357 YCLLGEAYSNVCIDFSQNMDFYFGPVRRTVAALTQWFT 394
gi 597762930 349 YCVVSGAYSNVCTDFSQNIDFYFGPVRRSMVSITHWFT 386
gi 768935020 588 YCALGDIHSSICQDFTRNADFYMDQIQRGIYYLQNWFg 625
gi 679216874 363 YCTFGDMESPVCTDFAANMDFYYTQILQRMEELKHWIA 400
gi 565314677 370 YCTLGNTESAVCTDFTANVDFYHNQIQKGIEELKHWIT 407
gi 637257071 657 YCTFGDAESPVCTEFATNVDFYCTRILQGIEELKHWIF 694
gi 542244123 798 YCALGDAQSSVCQDFSRNADFYINQIQRGIARIQHWFT 835
gi 551525680 253 YCTLVDTYSNICTDFAQNVDFYVTNARGFLEGLGQWLP 290
gi 941764128 744 YCALGDAQSSVCQDFSRNADFYFGQIRRGITRLQHWYS 781
gi 768935018 748 YCALGDIHSSICQDFTRNADFYMDQIQRGIYYLQNWFg 785
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap