5FUR


Conserved Protein Domain Family
zf-CCHC_6

?
pfam15288: zf-CCHC_6 
Click on image for an interactive view with Cn3D
Zinc knuckle
This Zinc knuckle is found in FAM90A mammalian proteins.
Statistics
?
PSSM-Id: 317662
View PSSM: pfam15288
Aligned: 19 rows
Threshold Bit Score: 57.7531
Threshold Setting Gi: 558109631
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30
                   ....*....|....*....|....*....|....*.
5FUR_G        1282 KLKCGACGAIGHMRTNKFCPLYYQTNAPPSNPVAMT 1317
gi 344246099    14 RVKCKDCGAFGHTLRSRRCPIKCAYGFLVPQAQEGR 49
gi 1040114246   40 RVKCKNCGAFGHMTHSRRCPIKCSDGTLTLQPMGPN 75
gi 831232705    22 RIKCKECGAFGHRASSRRCPIRKCPGALCPQPVFPN 57
gi 148700966    37 MVKCRNCGGFGHNVRSRMCPMKQGHVLLVSQPLGAR 72
gi 296221593    40 RVKCKDCGAFGHTTRSTRCPMKCWHGVLVLQTCGKK 75
gi 397520040  1279 KLKCGACGAIGHMRTNKFCPLYYQTNVPPSKPVAMT 1314
gi 731515777    79 RRKCKNCGAFGHTTRSKRCPIKCWSGATHPcrpmpf 114
gi 344240142    35 RMKCKNCGAFGHTMRSKKCPIKSWDGAKVPLPLGIK 70
gi 81905132     33 RVKCRDCGAFGHTVRSRKCPIKCWDGAKAPLPLGVK 68
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap