Conserved Protein Domain Family
Syntaphilin

?
pfam15290: Syntaphilin 
Golgi-localized syntaxin-1-binding clamp
Syntaphilin or Syntabulin is a family of eukaryotic proteins. Syntaphilin binds to syntaxin-1 thereby inhibiting SNARE complex formation by absorbing free syntaxin-1. So it is a syntaxin-1 clamp that controls SNARE assembly.
Statistics
?
PSSM-Id: 317664
View PSSM: pfam15290
Aligned: 23 rows
Threshold Bit Score: 258.601
Threshold Setting Gi: 992213717
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 765124351   77 DCSPTKGR-QKY-TCSDNHGIRPPPPEQYLTPLQQKEVCIRHLRAKLKETVNTLQDRDTEIDELRGQLYRMQEDWVEEEC 154
gi 990001398   47 DSSPTPRRsMKYtLCSDNHGIKPPTPEQYLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEIDDLKTQLSRMQEDWIEEEC 126
gi 1022994137  33 DSSPIMRRpGRYmSCGENHGVKPPNPEQYLTPLQQKEVTVRHLKTKLKESESRLQERETEIAELKSQLARMREDWIEEEC 112
gi 512976358  106 DCSPVMRRsGRYmSCGENHGVKPPSPEQYLTPLQQKEVTVRHLKTKLKESERRLHGRETEIVELKSQLARMREDWIEEEC 185
gi 742216891  258 DCSPVMRRsGRYmSCGENHGVKPPNPEQYLTPLQQKEVTVRHLKTKLKESERRLHERESEIVELKSQLARMREDWIEEEC 337
gi 545226102  120 DCSPIMRRsGRYmSCGENHGVKPPNPEQYLTPLQQKEVTVRHLKTKLKESERRLQERETEIVELKSQLARMREDWIEEEC 199
gi 554856001   46 ECSPTKGRhQKYtSCTDNHGIRPPPPEQYLTPLQQKEVCIRHLRAKLKETINTLQDRDTEIDELRGRLYRMQEDWVEEEC 125
gi 768913150   98 DCSPTKRHhQRYkSCTDNHGIRPPPPEQYLTPLQQKEVCIRHLRARLKETVNTLQDRDTEIDDLRSQLYRMQEEWVEEEC 177
gi 637343939   78 DSSPTPRRpVKYlLCSDNHGIKPPTPEQYLTPLQQKEVCIRHLRARLKDTHERLQDRDSEIDDLKTQLSRMQEDWIEEEC 157
gi 586533696   91 DSSPTPRRsMKYtLCSDNHGIKPPTPEQYLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEIDDLKTQLSRMQEDWIEEEC 170
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 765124351  155 HRVEAQMALKEARQEIQQLKQAVDTVRARLSDAggfsgDAGVQKYFQDINAQNHKLENLLISMELAQAGLAKEgssmpgc 234
gi 990001398  127 HRVEAQLALKEARKEIKQLKQVIDTVKNNLIDK-----DKGLQKYFVDINIQNKKLETLLHSMEVAQNGTAKE------- 194
gi 1022994137 113 HRVEAQLALKEARKEIKQLKQVIETMRSSLADK-----DKGIQKYFVDINIQNKKLESLLQSMEMAQNGSLRD------- 180
gi 512976358  186 HRVEAQLALKEARKEIEQLKQVIETMRSNLADK-----DKGIQKYFVDINIQNKKLESLLQSMEMAHSGSVRD------- 253
gi 742216891  338 HRVEAQLALKEARKEIKQLKQVIETMRSSLADK-----DKGIQKYFVDINIQNKKLESLLQSMEMAHSGLLRD------- 405
gi 545226102  200 HRVEAQLALKEARKEIKQLKQVIETMRTNLADK-----DKGIQKYFVDINIQNKKLESLLQSMEMAHNGSRRD------- 267
gi 554856001  126 HRVEAQLALKEARQEIQQLKQAVDTVRARLSDAgglsgDVGVQKYFQDINAQNHKLENLLLSMELAQAGLAKEaeampgc 205
gi 768913150  178 HRVEAQLALKEARLEIQQLKQAVDTVCARLSDAdginmDVDVQNYFKDINAQNHKLENFLVHMELAQARLARD------- 250
gi 637343939  158 HRVEAQLALKEARKEIKQLKQVIDTVKNNLIEK-----DKGLQKYFVDINIQNKKLETLLQTMEVAQDGAGKE------- 225
gi 586533696  171 HRVEAQLALKEARKEIKQLKQVIDTVKNNLIDK-----DKGLQKYFVDINIQNKKLETLLHSMEVAQNGTAKE------- 238
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 765124351  235 rtrvggsapasvsgespggapkltvggrG-----------------------------------SCSCDaSPARSLTRSS 279
gi 990001398  195 ----------------------------Dgt--------------------------------gESAGG-SPARSLTRSS 213
gi 1022994137 181 ----------------------------Eqc--------------------------------lDYLCD-SPEKSLPPNT 199
gi 512976358  254 ----------------------------Elc--------------------------------lDLPCG-SPKKSLALNT 272
gi 742216891  406 ----------------------------Elc--------------------------------lDFPCE-SPEKGLALGA 424
gi 545226102  268 ----------------------------Elc--------------------------------lDFPCD-SPEKSLTLAT 286
gi 554856001  206 rtrvggsap---asvsgespggvpkltvGgr--------------------------------gSCSCDgSPARSLTRSS 250
gi 768913150  251 ----------------------------RepvpgcrvyvggsapasvsgespggiakanvagknSCSCGnSPARSLTRSS 302
gi 637343939  226 ----------------------------Ega--------------------------------aESAGG-SPARSLTRSS 244
gi 586533696  239 ----------------------------Dgt--------------------------------gESAGG-SPARSLTRSS 257
                         250       260       270
                  ....*....|....*....|....*....|
gi 765124351  280 TYTKLSDQAladr-nsnGVDFPclSGDGTQ 308
gi 990001398  214 TYTKLSDPAvcgdlppgDHPAS--SAEDGA 241
gi 1022994137 200 AYGKMADARa--------LEDQ--TIEEGA 219
gi 512976358  273 PLGKMTDGLs--------VDGQ--VTEEGA 292
gi 742216891  425 ALGPTEDALs--------PEEP--ATEEGA 444
gi 545226102  287 PFGKMADGLs--------LEEQ--IIEEGA 306
gi 554856001  251 TYTKLSDQAladr-ndnGSDFPclSGDGTQ 279
gi 768913150  303 TYTKLSDQTlpdr-nghGLDFPclSGDGAH 331
gi 637343939  245 TYTKLSDQGaadr-nigGSQTI--SVDDAA 271
gi 586533696  258 TYTKLSDPAvcgdlppgDHPAS--SAEDGA 285
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap