Conserved Protein Domain Family
NUFIP2

?
pfam15293: NUFIP2 
Nuclear fragile X mental retardation-interacting protein 2
Statistics
?
PSSM-Id: 317666
View PSSM: pfam15293
Aligned: 12 rows
Threshold Bit Score: 779.81
Threshold Setting Gi: 768939393
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 554565230  90 KKKTGYGELNGNAGEREI-PLKNLGSDEATNPI-SRVLNGNQQIVDTNL--KPTIKSSTFGKAGIKTRNFIQKNSMDKKN 165
gi 558155571  90 KKKTGYGELNGNAGEREI-PLKNLGSDEATNPI-SRVLNGNQQIVDTNL--KPTIKSSTFGKAGIKTRNFIQKNSMDKKN 165
gi 556980893  51 KKKTGYGELNGNAEDRRVgSIKSLDLNDLNNPVpSRVTNGNQQLVDTNSnlKQAEKASAFNKVASNKKNFNQ--NMDKKN 128
gi 301617684  68 QKKTGHGDLNGTATERYP-SPKTLDSEKAASQTaSRVTNGNQQAIDSNAstKHSSKALSFGKSGSKVKTLLHKNSMDKKN 146
gi 327284996 102 RRRTGYGELNGNAGEREC-SLKGLNAGDVSGPI-SRVTNGSQG--DTTFtlKPMAKGVPFGKPGLKPKGFLPKAGMDKKS 177
gi 542249243  46 TKKTGNKKVSISDEEGEK-NPHLSNAVGMSHPP---SINANRHTINTNAkpKSTQKLCT-TVPKISIKGLDHKKSMDLKN 120
gi 941797064  43 qetqakktgsknviindeegeknphlpytvgmshssssNGNRHISNSNVkqKGPQKHYI-SVQKVSSKFSEHKKNMDLKN 121
gi 768939393  46 TKKTGNEYINSEEEGGKS--PRVSDAVDMSHPP---NSNGNRH-----VkqKSSQKLYT-AVPKVSSKGLEHKKNMDLKH 114
gi 292621571  45 TKKTENGKVNGTLKEGEV-TPTSFKPDSSLHPA---NSNGERHLLDINLkqKPTRRAFTADSTGDRKVRNTSRNSMDFKN 120
gi 597750654  46 TKKTENGKVNGSIVEGEE-TPTFLASESYLHSV---SHNGDKVLLETNLkrKPPGKTFNTALKGEGKGNNTSRNSMDYRH 121
gi 149641826  90 KKKTGYGEINGNAGD----VPKSLGSDEATSPI-SRVLNGSQQAADTNLnpKQTVKTSTLGKAGLKTKNFIQKNSMDKRN 164
gi 525018810  55 cnsLCYGELNGNAGEREV-SLKGLCSDEATTPG-SRVPNGSQQLVDSNAtpKQPVKASTLGKAGIKTKNFIQKNSMDKKN 132
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 554565230 166 --GKSYESKSGENQSVDKSDTITIPNGVVTNNSGYITNGYMGK-GADNDGSGSESGYTTPKKRKARRNSAKGCENLNLVQ 242
gi 558155571 166 --GKSYESKSGENQSVDKSDTITIPNGVVTNNSGYITNGYMGK-GADNDGSGSESGYTTPKKRKARRNSAKGCENLNLVQ 242
gi 556980893 129 --DKTFESKALD------KEALLLPNGVVTNNSGYITNGYLGK-AADNDGSGSESGYTTPKKRKARHNSIKSSENLNLFQ 199
gi 301617684 147 --EKSYESKPKDNKHTDKVEAGPIQNGLLANNSGYITNGYVSK-GAENDGSGSESGYATPKKRKARCSNAKVVDGSSFVI 223
gi 327284996 178 --EKCYESKARE----EKSEVVSIPNGVVTNTSCYITNGYAGK-GADNDGSGSESGYTTPKKRKGRHNSIKGCESL---- 246
gi 542249243 121 nkEKVQDLSHHEGPPLDKKDSVLLQNGVV--NCGLITNGYSSK---DNDGSSSEGGYTTPKKRKTRCNNTKNTDNVIREK 195
gi 941797064 122 dkEKALDLSHYEIQPSNKKDSALLQNGLV--NCGLITNGYSSK---DNDGSGSEGGYTTPKKRKSRCGNTKSADNVTKDK 196
gi 768939393 115 dkEKTLELNNHEGQTLDKKDLFLLQNGVI--NCGLITNGYSSK---DNDGSGSEGGYTTPKKRKARCNNPRNGEHLTREK 189
gi 292621571 121 --DKSSELNTLE----GKKEVLASLNGVISINSVPLTNGYPSKpGADNDGSGSESGYTTPKKRRAQRNGKAGDNVTASAQ 194
gi 597750654 122 --DKPSELITLE----GKKEALASLNGVVSLNCGPLINGYPGKpGTDNDGSGSESGYTTPKKRRAQRNGKAVEYVTASAQ 195
gi 149641826 165 --EKSYDSKSRENPSIDKAEAVSIPNGVVTNNASYITNGYVGK-GADNDGSGSESGYTTPKKRKARRNSAKGCENLNLLQ 241
gi 525018810 133 --EKSYENKHRENQSSDKPEGVSIPNGVVTNNSSYITNGYVGK-GADNDGSGSESGYTTPKKRKGRRNSAKGCENLNLVQ 209
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 554565230 243 DKIMQQEts-vpT-LKQGLETFKPD-YSEQK-GNRVDGSKPIWKYETGPGGMSRGKP----------AVGDMLRKSSDIK 308
gi 558155571 243 DKIMQQEts-vpT-LKQGLETFKPD-YSEQK-GNRVDGSKPIWKYETGPGGMSRGKP----------AVGDMLRKSSDIK 308
gi 556980893 200 DKTIQQEms-spV-LKPELDISKPE-SGDPK-GVRLENAKPVIKYE--VSGAGRGKI----------GSGDIQRKNSDVK 263
gi 301617684 224 DKMIDSD-------VKFESENSKPDlLVDQKgGARLDNGKSSWKCEAAASGAGRGKP----------NSADLQRKNSDTK 286
gi 327284996 247 EKIAPQD-----PpVVPEPEGFKPDgDGDTKaGSHIEGLKPAWKCEGATMGMGRGKP----------GTVEVPRKNSDTK 311
gi 542249243 196 ERDMQQG-----H-TTEELGALNLE-TNEKGmTSRLDGFRATQKVETQS----TAKRavv----seaSVGESQRKNSDGK 260
gi 941797064 197 ERDMQPR-----N-TTP--GASSVE-TPEKGtASRLDGFRSSYKAEAQT----TAKRava----setSVAEPQRKTSEGK 259
gi 768939393 190 EKDMQQH-----N-TTQEHEAFKLD-TIEKGlNSRLEGFRAAHK-DAQP----AGRRtaa----setLVAESQRKNTDGK 253
gi 292621571 195 GKAMQQ------G-GKQEHGPLALE----SAsGAQVESGRGGSKAEPYL----KAKEppacatppplPVTELQRKNSDSK 259
gi 597750654 196 GKAMQQ------A-NKQDPSPAAQE-LVDRTtGSQVDLGRAASKADGNLGGSVKAREalasa-tatpPASEVQRKNSDGK 266
gi 149641826 242 DKIMQQEigapsS-LKQGLDGFKPD-YNEPK-GNRMDGSKPLWKYEPGAGGLGRGKL----------GIGDILRKNSDAK 308
gi 525018810 210 DKIMQQEvs-apT-LKQELDSFKPD-YSEQK-GNRIENTKPVWKYEAGAGGAGRGKP----------GLGDVPRKNSDAK 275
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 554565230 309 P-GVSSKKFDDR-PKGKHA--SavA--SKEDSWTLFKPPPVFPVDNSSAKIVPKISYASKVKENLNKTVQ-----NSSVS 377
gi 558155571 309 P-GVSSKKFDDR-PKGKHA--SavA--SKEDSWTLFKPPPVFPVDNSSAKIVPKISYASKVKENLNKTVQ-----NSSVS 377
gi 556980893 264 P--AVSKKFEDK-SKGKAT--A--AvaSKDDSWTLFKPPPVFPVDNSSAKIVPKISYASKVKENLNKSAQ-----NLS-S 330
gi 301617684 287 T--VPGKKFDDR-PKGKASttA--S--SKEDSWSLFKPPPVFPVDNSSAKIVPKISYASKVKENLNKAAL-----NNSAS 354
gi 327284996 312 V-GIVGKKFEER-PKGKPI--S--A--SKEDSWTLFKPPPVFPVDNSSAKIVPKISYASKVKENLNKSAQ-----NPTSS 378
gi 542249243 261 TvGTFGKKTEER-HKGKLS--S--P--SKEDSWTLFKPPPVFPVDNSSAKIVPKISYASKVKENLNKVAQ-----GGGEA 328
gi 941797064 260 AaGTFGKKAEEK-HKGKLS--S--P--SKEDSWTLFKPPPVFPVDNSSAKIVPKISYASKVKENLNKVAQ-----GGGEA 327
gi 768939393 254 TvGTFGKRTDER-HKSKLS--S--P--SKEDSWTLFKPPPVFPVDNSSAKIVPKISYASKVKENL-KVAQgggggGGGET 325
gi 292621571 260 A---AGKRFEDRsSKVKVA--S--S--TKEDSWTLFKPPPVFPVDNSSAKIVPKISYASKVKENLNKTAQ-----AGGEA 325
gi 597750654 267 V---VGKKFEDKsSKVKVA--S--S--AKEDSWTLFKPPPVFPVDNSSAKIVPKISYASKVKENLNKTAQ-----AGGEA 332
gi 149641826 309 P-GMNSKKFEDR-PKGKHA--AavA--SKEDSWTLFKPPPVFPVDNSSAKIVPKISYASKVKENLNKAAQ-----SSSVS 377
gi 525018810 276 P-GISSKKFDDR-PKGKHA--SsaT--SKEDSWTLFKPPPVFPVDNSSAKIVPKISYASKVKENLNKAAQ---------T 340
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 554565230 378 PSSSSSSSSsa-------------gENQtqSSSRLSQVPMSALKSVTSANFSNGPVLAGTD-ASVYS-------PGGQPL 436
gi 558155571 378 PSSSSSSSSsag-----------enQTQ--SSSRLSQVPMSALKSVTSANFSNGPVLAGTD-ASVYS-------PGGQPL 436
gi 556980893 331 LSSMGETPA----------------QAQ--SSGRLSQVPMSAMKSVMSPSFSNGPVLGGTD-GNICP-------PGVQPI 384
gi 301617684 355 LSSHAFSPAa--------------gEVP--TLNCVSQVPMSAMKSVSTANFSNGPLLVGPD-G---------------SF 402
gi 327284996 379 LSSSSSSSSssssssslclssatdgPLP--TPNRLSQVPMSAMKSVTSVNFSNGPVLAGADrGVSCP-------AGTQSL 449
gi 542249243 329 LPPP----------------------------VRLSQVPMSAMKTITSASFTNGPVSGNGN-GC----------PSVGTF 369
gi 941797064 328 APPP----------------------------VRLSQVPMSAMKTITSASFTNGPVPGNGN-GC----------PSVGTF 368
gi 768939393 326 PPPP----------------------------VRLSQVPMSAVKTITSASFTNGPVPGNGN-GC----------P-VGTF 365
gi 292621571 326 LTPAPQVP------------------------GRPPQVPMSAVKTITSASFTNGPLPGEGN-GCPLPgph----fsSGPL 376
gi 597750654 333 LSPAPQVP------------------------GRPSQVPMSAVKTITSASFTNGPLAGEGN-GCSLPgthfssvAGSGPA 387
gi 149641826 378 PSSSSSSSSss------------tgEAQaqTSSRLSQVPMSAMKSVTSATFSNGPVLAGTD-GSLYS-------PGTQPL 437
gi 525018810 341 PSTSSSSSSss------------agETQaqTSSRLSQVPMSAMKSVTSASFSNGPILAGSD-GSVYS-------PGAQPL 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 554565230 437 LTTAANSMTLIsA--A-IDPVLQDKSLTSAAV---------EQITTSLFIYP---SNMQTVLVSAA-QVDLPS-QTD-QQ 498
gi 558155571 437 LTTAANSMTLI-S--AaIDPVLQDKSLTSAAV---------EQITTSLFIYP---SNMQTVLVSTA-QVDLPS-QTD-QQ 498
gi 556980893 385 FTTAANIVSPTsS--GsETVMSLDGGPPLVTA---------EQKKCSLFVYP---SNTQSVLPGTT-QVELLS-QTN-QQ 447
gi 301617684 403 LATAASTLSHTlP--AgAETLPTDILSAPTPN---------EQKKPSLLTYP---LNMQQALPDTM-QGEL-SgQSN-QH 465
gi 327284996 450 LVPASGALLFTpS-----ESVPPD-----TAL---------GEPKPSLLIYP---SNMQALLLDAAsRAESASfQGHlQQ 507
gi 542249243 370 LAPAASSIPSAqSilS-GDNVASPLESNCSSTtspvdgeayELRKCTLLIYP---LNMQPVLPSAR-HLDPPAaQTN-QK 443
gi 941797064 369 FAPAASCVQSApSvpS-GENVASSLESSCSSTtspvdgeasELRKCTVLIYP---LNMQPVLPSAR-HLDPPAaQTN-QK 442
gi 768939393 366 FAPAASSIPPPpPp-S-GENVASPLEINCSSAsspvdgdahELKKCTLLIYP---LNMQPVLPSGC-HLSSAAaQTN-QK 438
gi 292621571 377 LATPTVATENVaSp-P-GSGTMAIGSSTTSLA---------EPRKPSLFVYPitpSNMQLSLPSGR-QADPPAaPTN-QK 443
gi 597750654 388 LASSAAGADNVaYp-S-GSGS----TTNTCTA---------EPRKPNLFVYPvtqSSMQLSLPSGR-QADPPAtATN-QK 450
gi 149641826 438 LAAAASTVPPVpG----VDSVLQDTSITSAAV---------EQIKSSLFIYP---SNMQTVLLGTT-QVALPT-QTD-QQ 498
gi 525018810 401 LSTAASTVPSTsS----ESVVPQDTSTTSTTL---------EQKKSGLFIYP---SNMQTVLLGTA-QVDFPS-QTN-QQ 461
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 554565230 499 NLGDIFQNQWGLSFINEPSAGPETVTGK-SSDHKAMEVTFQGEYPATLVSQGAEIIPSGTE-HPV-FPKAYELEKRTSPQ 575
gi 558155571 499 NLGDIFQNQWGLSFINEPSAGPETVTGK-SSDHKVMEVTFQGEYPATLVSQGAEIIPSGTE-HPV-FPKAYELEKRTSPQ 575
gi 556980893 448 NLGDIFQNQWGLSFINEPSAGPEPAAGN-STDNKIMEVTFQGECAATLVSQGAEILPSGTE-RPV-FPKAYELDKRTSPQ 524
gi 301617684 466 SLGEIFQNQWGLSFINEPSAGPDAGVDK-PSLGQMV-----WEHPIPAASQGAEVAASGNE-RPV-FPKAYELEKRTSPQ 537
gi 327284996 508 NLGDIFQNKWGLSFINEPSAGPE----K-PAEGQAPEVTFQGEFPGTLAA------PTGPN-PPPaFPKAYELDKRTCPP 575
gi 542249243 444 ALGDIFQNQWGLSFINEPNLGPEGGNGPvPGEDKTTVVTSNSECQAVAAKVAQPCFDISPSlLEP-GPLVQDPEKRTCTP 522
gi 941797064 443 ALGDIFQNQWGLSFINEPNPALDGGNGFvPAEDQTS-VTSHNGSQAVPAKVAQPLFDISPf-LEA-EAFSQEAEKRTCAP 519
gi 768939393 439 ALGDIFQNQWGLSFINEPNLGPEGG-GElPAEDKSVLAAPQSDRPAA----ARPCFDAGPSfLEP-GTLVQDLDKRTCP- 511
gi 292621571 444 SLGDIFQNQWGLSFINEPSAGPEGVACRsNGKDVLTEVSFQGGSP--VATQTSSTSQRPDQ--PP-FTKAHEPDKRTNAQ 518
gi 597750654 451 SLGDIFQNQWGLSFINEPSAGPEGLVCRsTAKDKPVEVSFQGGCSATVVTQASGTSQRPDQpPPP-FPKAYELDKRTSSQ 529
gi 149641826 499 NLGDIFQNQWGLSFINDPSAGPETGPGE-ATDHKMMEVTFQGECPAALVSQGAEIIPSGPE-YPV-FPKAYELDKRTSPQ 575
gi 525018810 462 NLGDIFQNQWGLSFINEPSAGPETVVGK-SADNQLMEVTFQGEYPATLVSQCAEIIPSGTE-QPV-FPKAYELDKRTSPQ 538
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 554565230 576 -V---LGSILKS-G--TTNESGALSLEPS---HIGDLQKAD-TSSQGALVF--LSKDYEVEnqNPLASPTNTLLGSAKEQ 642
gi 558155571 576 -V---LGSILKS-G--TTNESGALSLEPS---HIGDLQKAD-TSSQGALVF--LSKDYEVEnqNPLASPTNTLLGSAKEQ 642
gi 556980893 525 -V---LSGILKP-VpiTASEGGAMSTALH---QSIELQK-D-GGVQGAIVF--VSKDCGIE--TPQALPTNSLFSSVKEQ 590
gi 301617684 538 vP---EGSTMKT-TvdSGAEGSGLCSDLQ---HLGEPQKTD-AASQGCLVF--QSKVYELDi-SPQAPLKNTLQTSAKDK 606
gi 327284996 576 pL---LNSILKLgTpgDGGGGGGFFLDSH---PSGGPHLADlGGPGGPFVF--LAKDCHVE--NRLASPTNNLLASAKEQ 645
gi 542249243 523 cI---VSNACPP-AygMSEE------ENKlqpCGKEKTQ----GAGTAVLA--PSKDNGAK--PAQGQLTTLLFGSSKEQ 584
gi 941797064 520 cQ---VSSVCSP-AstASEE------ETKlqpSVQAKTKVElKGVGSSLLA--PSKDNGAK--PAVGQQTTVLFGSSKEQ 585
gi 768939393 512 -----ASNACSP-ArdPTEE------EHK---RLQLKTKAEgKGSGSAGSS--GGRESRVK--PAQPPLSTLLFGSSK-- 570
gi 292621571 519 sR-----SVCGG-AtaAS----GAVPETF---VLSLDTQRDeTGVHGAIVFcsSSKDICAE--LPPSSPAAPKVALAKDQ 583
gi 597750654 530 sMgkgVNLVLPV-AsaPAPE--GS-PQAS---NLGLDSQKDeAGVPGAIVFcsSSKDVGAE--LTRTSPAGPKLSLAREQ 600
gi 149641826 576 -G---PGSVLKP-G--TTSEGEAFSSEPS---HTGDLPKAD-PGSQGALVF--LSKDYEID--NPLGSPSNTLLASAKEQ 640
gi 525018810 539 -I---LSAILKP-G--TAVEGGVLALESH---HTGDLQKAD-TGSQGALVF--LSKDYEVE--NPLASPTNNLLASAKEQ 603
                        650       660       670       680
                 ....*....|....*....|....*....|....*....|....*..
gi 554565230 643 RYQRGLERNDSWGSFDLRAAIVYHTKEMESVWNLQKQDPKRIITYNE 689
gi 558155571 643 RYQRGLERNDSWGSFDLRAAIVYHTKEMESVWNLQKQDPKRIITYNE 689
gi 556980893 591 KYQRDLERKDSLSSFDIRAAVTYHTKEMEFVWNLQKQvatmsltgaq 637
gi 301617684 607 RYHAGLEWKDSCGSFDLRAAIIYHTKEMESILNLQKQDPSRIITYNE 653
gi 327284996 646 RYPRGLERKESWGDFDLRAAVLYHTQEMESLCNLQKQDPKRIITYDE 692
gi 542249243 585 VLSKDISTRCSWGSFDVKAAVTYHTKEMESVFNLQKQDPKRVVIYGE 631
gi 941797064 586 IHPKDVGRRSSWGSFDLKAAVTYHTKEMESIFNLQKQDPKRIVFYNE 632
gi 768939393 571 ----DCGRTCSWSCFDIKAAVAYHTKEMEFIFNLQKQDPKRVVFYHE 613
gi 292621571 584 GHAKGFDRRSSWGSFDLKAAVIYHTKEMEYILNLQKQDPNRVVLFSE 630
gi 597750654 601 GHTKGFDRRSSWGLFDLKAAVVYHTKEMETILNLQKQDPNRVVLYSE 647
gi 149641826 641 RYQRGLERKDSWGSFDLRAAIVYHTKEMESIWNLQKQDPKRIITYDE 687
gi 525018810 604 RYQRGLERKDSWGSFDLRAAILYHTKEMEAVWNLQKQDPKRIITYDE 650
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap