Conserved Protein Domain Family
AJAP1_PANP_C

?
pfam15298: AJAP1_PANP_C 
AJAP1/PANP C-terminus
This family includes the C-terminus of adherens junction-associated protein 1 (AJAP1) and of PILR-associating neural protein (PANP). AJAP1 inhibits cell adhesion and migration. PANP is a ligand for the immune inhibitory receptor paired immunoglobulin-like type 2 receptor alpha.
Statistics
?
PSSM-Id: 317671
View PSSM: pfam15298
Aligned: 9 rows
Threshold Bit Score: 304.128
Threshold Setting Gi: 733918200
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123885712  165 ILWGPTGDDdV-----ESStfP--GIYETTRTStvh--arTTLLETTTTTT-----ASTTTNVKVTTLQNpgih------ 224
gi 657558574  178 IDWGPTGTD-Sid--dDGK--PdpNVTLSTRAS-------VTTVAATTSTT-----TRLSQRTLTVVTTP---------- 230
gi 765169321  171 IDWGPTGTD-Svd--dDGKrgP--NVTLSTRAS-------SVTTATTAGTT-----PRLSQRTLTVVTTP---------- 223
gi 1033377638 124 IVWGSTSPLdPl----ESStfP--GIYGSTTVSvlqrttrTTTTTATTSTT-----TFTTTAATPTTVQPkgpgpg---- 188
gi 612026308  172 IAWGPTGEEeSv----ESStsP--GIYGPTTVSilq--trKTTVATTTTTT-----------TSYITRQPkgftpslspv 232
gi 664767317  140 IAWGPTGEEeAl----ESNtfP--GFYGPTTVStfq--trKTTVATTTTTT-------TATTATSMTLQTkgvtep---- 200
gi 733918200   10 IVWGPTGEEdSl----ESStlP--SIF-------------TTAATTTVTTT-----TAATTAATTVATVPtpsspa---- 61
gi 597755488  163 IEWGPTGTDeGle--dDVKavP--NTITTTKASt------TTTTTTTISTT-----TRSPQRTYAVVTTP---------- 217
gi 973211918  174 IDWGPTGGDdTstgenGDKpvP--NSTVARKPP-------TATAATIITTTvttksPRNTPKSPPVVTTT---------- 234
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123885712  225 ---ngkkSP-GRIST-TdpnPGN---GK--TARPPRIPNDTSGLAVHQIITITVSLIMVIAALITTLVLKNCCAQSGNAR 294
gi 657558574  231 -------ES-KSTTKpT---IGI---TE--TVKPPKPYGDTPGLAVHQIITITVSLIMVIAALITTLVLKNCCAQSGNGR 294
gi 765169321  224 -------ES-R--ST-TkspHSH---SE--TATPPR-HGDPPGLAVHQIITITVSLIMVIAALITTLVLKNCCSQSANGR 286
gi 1033377638 189 -fgtprnNP-GGLST-MgppATSdgnRKevDAPPPKMPGDNSGLAVHQIITITVSLIMVIAALITTLVLKNCCAQSGNTR 265
gi 612026308  233 isqnspnYP-GRIST-TessPGPqgnGK--DITPPRILGETSGLAVHQIITITVSLIMVIAALITTLVLKNCCAQSGNTR 308
gi 664767317  201 -ldprnrIP-VGFST-TepsTSP---SK--D-KPPRILGETSGLAVHQIITITVSLIMVIAALITTLVLKNCCAQSGNTR 271
gi 733918200   62 -ptpgieEPrGRPST-SepaAGHssgGK--DARPPRGLGDTAGLAVHQIITITVSLIMVIAALITTLVLKNCCAQSGAAR 137
gi 597755488  218 -------HP-RRLST-TqptVNL---GV--TAKPQKPFGDTPGLAVHQIITITVSLIMVIAALITTLVLKNCCAQSGNGR 283
gi 973211918  235 ----------RKLTT-TqssVSF---GE--TIKPPKPFGDTAGLAVHQIITITVSLIMVIAALITTLVLKNCCAQSGNGR 298
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 123885712  295 RNSHQRKINQQEESCQNLTDFTPASVPSNMDIFTAYNETLHCSHECIRTPVPVYTDEALHQTGAFKTTFNGNR 367
gi 657558574  295 HNSHQRKIHQQEESCQNLTDFTPARVPSKVDIFTAYNDSLQCSHECVRTAVPIYTDEMIQQTPVYKTAYNGNR 367
gi 765169321  287 HNSHQRKIHQQEESCQNLTDFTPARVPSKVDIFTAYNDSLQCSHECVRTAVPIYTDEMIQQTPVYKTAYNGNR 359
gi 1033377638 266 RNGHQRKINQQEESCQNLTDFTPARVPSNLDIFTAYNETLQCSHECVRTPVPVYTEETILSPGDYKASFNGSR 338
gi 612026308  309 RNSHQRKINQQEESCQNLTDFTPARVPSNLDIFTAYNETLQCSHECVRTSVPVYTDETLHPTGEYKTTFNGNs 381
gi 664767317  272 RNSHQRKINQQEESCQNLTDFTPARVPSSLDIFTAYNETLQCSHECVRASVPVYTDETLHPTGEYKSTFNGNR 344
gi 733918200  138 RNGHQRKITQQEESCQNLTDFTPARVPSSLDIFTAYNETLQCSHECVRTPVPVYTEEALHSPGDYKATFNGNR 210
gi 597755488  284 HTSHQRKINQQEESCQNLTDFTPARVPSKVDIFTAYNDSLQCSHECVRTAVPVYTDEMIQHTPIYKTTYNGNR 356
gi 973211918  299 HNSHQRKINQQEESCQNLTDFTHARIPSSVDIFTAYNDSLQCSHECVRTAVPVYTDEMIQQTPVYKTAYNGNR 371
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap