Conserved Protein Domain Family
VAD1-2

?
pfam15310: VAD1-2 
Vitamin A-deficiency (VAD) rat model signalling
VAD1-2 is a family of proteins found in eukaryotes. The family is expressed in testes and is involved in signalling during spermatogenesis.
Statistics
?
PSSM-Id: 317683
View PSSM: pfam15310
Aligned: 11 rows
Threshold Bit Score: 278.278
Threshold Setting Gi: 940773874
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81884137  124 VCGHFRSTPVQTSKHLFWSNKLIQASEHSLQTALEKHHKSPGEKKS---I---------------SIAQVYTEC------ 179
gi 982958293 276 MDEDYRSIHVQTSRHLFWVDRLIQVSEHSLQPVISTQPFQKSTKKT---Ticpaqqt-vpkdtesSKKQSQNPSaqqgpl 351
gi 831219608 114 VFTEHRSIRVQTSKHLFWANKLIQASEHSLQKEINVHLKKSGGDKT---Tshlgqnf-ihtntpsSKNQVQTSSahsdhp 189
gi 545178672 355 VYPDHRSIRVQTSKHLFRADKLIQASEHSLQRAISMQPRkKSMSET---Tscsdqel-vfkdtlcSEKQLQNPSpqpalp 430
gi 940773874 243 VDSTHRSIFVQTSKHLFWADKDVQASEYSLDLETGMQRGeS----TekiAsppnqk---avpepvPVKQFQDEStqaelp 315
gi 545510246 267 VSTNHRSICVQTSKHLFWADKLIQASEHSLERMTDTQLG-KNKGKT---Ishlgqqs-vpkdttcSKKQLQTPSaqpapp 341
gi 332243191 123 MSACHHSISAQTSKHLFWANKLIQASEHSLQRAINMQLNnGSAGQP---Irsplrea-iptnalcSEEQLQIPDahsapp 198
gi 532085188 229 tgpeqRSIRVQTSKHLFWANKLIQASEHSLQQAINRHhpkqeav--------------------------------tfrq 276
gi 511906126 123 VSTNHRSIRVQTSNHLFWADKHIQASERSLRRAIS-----NNIGKP---TscqdqksdledacvcCIKQIENPSaqpapp 194
gi 752404559 199 ASANRRSIRVQTSKHLFWADKHIQTSEHSLQHVLHRQPC-KNTGKT---Sgcqdqqc-vprdamcSKKQLQNSSaqpapp 273
gi 755791130 112 ASANHRSIRVQTSKHLFWADKLIQASEHSLQQAVGRQLDkKGTGKA---Tshqdqqs-nlkdatcSKQQLQSPHaqpapp 187
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81884137  180 ---TQRPSSTQVsrTPTPTALGLADLINFASSLAVASSSNMALPNLGTMIKGTSEKAQNTSLDF---------------- 240
gi 982958293 352 dkaSQKTLSPEP--SFCTPTMGLEELINFASTLAMASSSRMDLPRLQHMIKTTPQKAMPPPTEPa--------------- 414
gi 831219608 190 atgSQVPPSTHLssSSLSPAIGLAELINFASSLAMASSSKMNLPNLEHIIKAQSQKTEEPSTEP---------------- 253
gi 545178672 431 atgSQQPPSPCLssSNLSPGLSLAELINFATSLAMASSGKVDLLNLEHMIKDPPKKVMEPSTEPavdpttqpamekpere 510
gi 940773874 316 epgTRQPSDTDVpsPYLTPAINLQDLVNFASSLAIASSSNRDLPNLEQMMKSPPQKAVEPSTVPtve------------- 382
gi 545510246 342 atdSQQLPNPYPssSSLSPAIGLEELVNFASSLAVASSSKMDLPNLEHMIKAPPQKAEAPSTDPt--------------- 406
gi 332243191 199 atsSQAPSP--LlsSDLPPPIGLAELITFASSLAMASSSRMDLPSLEHMMKAPPQEALEPSTEP---------------- 260
gi 532085188 277 vttSQPISSPCLstSSLPPSIGLEELINFASSLAVASND-MELPSLEQMIKAPSRKSAAPSKEP---------------- 339
gi 511906126 195 ttdSQQLSNPPPpsSSPSPGIDLADLVNFASSLAVASSSKMDLPNLEHMIKALPQKAEAPSTDPt--------------- 259
gi 752404559 274 ttdSQQPPNPHPssSSLSPGIGLADVVNFASSLAVASSSKRDLPSLEHMIRAPPQKVEAPSTDPa--------------- 338
gi 755791130 188 aadAQQPPDPHPasLSPSPAIGLAELINFASSLAVASSSNMDLPKLEHMIKAPPQKAEAPSTDPa--------------- 252
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81884137  241 -----C----QP-IQSIKFTQATQitQISSEKQDEPPEvmAHKSWTQETRNVACSYLDINESGLKKATIQGEVKFVQAPA 310
gi 982958293 415 -----VdhaaQPtTDEPEQGKLTKd-EKPPEEPGEARK--PQDAPKQEDEDVPHPYLDLRKPGFKRATIEGELKFLQSPT 486
gi 831219608 254 -----I----QPsTEPQKLGKQEE--I-PPEKPPEDGE--PQKTWNQEDKNLPRSYLDFSKLGAKRATIEGEMKLLQPPA 319
gi 545178672 511 epteeT----QPaMEKPEREEPTE--EL--EKPLEAGE--PQKAWKQGDENVPCPSFDFSKPGVKRATIEGEVNLLQPST 580
gi 940773874 383 ---stT----PPaKEEPEQEKLPEvqERASEKSLEAGE--PLEPAKQEDKTL-HPYFDFSKPEPQRTAFKGKVKFIRAPA 452
gi 545510246 407 -----T----QVaVDQPEKKKLTK--ELPDRPPLKARE--SQKAQKPQDKNFSHPYLDFSKPGIKRATIKGEVKLLQPPA 473
gi 332243191 261 -----L----LTtVEEREPEKHA---ETLPEKPREARA--PLKSWSQEDKNFAQAYFDFGKPGIKRATIEGQMQLLQPPA 326
gi 532085188 340 -----V----KPyTE-----------PLQPQNPPKAKE--PEKVPEQEKQKFP-SYLDF-KPGIKRATIEGEVKFLSTQD 395
gi 511906126 260 -----P----QLvMDQPEKENLTK--DLM-EKSLETEE--SQKAWKQEDKNVFCPYLDFSKPGIKRATIKGEVQLLQQPA 325
gi 752404559 339 -----A----QRaTDQPEGKNHSK--KLL-EKPLRAGE--SQKAWKQEDKNFFHPYLDFSKPGMKRATIEGQVMLLQQPA 404
gi 755791130 253 -----V----PPaVDQPEKEELAK--EWL-EKPLEAGE--PQKAWKQEDKSFPHSYLDFNKPGVKRATIEGEVKLLQAPT 318
                        250       260       270
                 ....*....|....*....|....*....|....*...
gi 81884137  311 TSPELQEDKDDSV-PGTKKGTPILLKIHFKLSSPQAPE 347
gi 982958293 487 TSPQPKGAAKDSV-PGTMKGNPLFLKIHFKLSSPSSPE 523
gi 831219608 320 IPPPLQGARKDSV-PGTKKGNPLLLKIHFKVSSPSIPE 356
gi 545178672 581 MSPRLQRAMNDSV-PGTKKGSPLLLKIHFKLSSPTSPE 617
gi 940773874 453 RSSSLNGDRKDSV-PGTKKETPLMLKIHFKLLPTSSPR 489
gi 545510246 474 MSPLPQGDMKDSV-PGTRKGSPLLLKIHFKAAegrrpg 510
gi 332243191 327 TSPLLQGGKEDSVpPGKEKENPLLVKIHFKLSAPTTPE 364
gi 532085188 396 IPATLQECKEDSV-PGTKKGNPLFLKIHFKLSSPSTPE 432
gi 511906126 326 RSPPPKGAVKGSV-PGTRKGSPLLLKIHFKVSSPTSPv 362
gi 752404559 405 RSPPPQGAVKDSV-PGTRKGSPLLLKVHFKMPSPTSPE 441
gi 755791130 319 ISPPPQGAVEEppqkpgrlpppdpgeerpcrmqkgrpq 356
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap