Conserved Protein Domain Family
FRG2

?
pfam15315: FRG2 
Facioscapulohumeral muscular dystrophy candidate 2
This family of proteins is found in eukaryotes. The family is localized close to the D4Z4 repeats on chromosome 4 and 10 that are associated with the autosomal dominant facioscapulohumeral muscular dystrophy (FSHD). FRG2 are transcriptionally upregulated in FSHD myoblast cultures suggesting involvement in the pathogenesis of FSHD.
Statistics
?
PSSM-Id: 317688
View PSSM: pfam15315
Aligned: 7 rows
Threshold Bit Score: 195.511
Threshold Setting Gi: 564317281
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74708395   61 SEPN--PNK-ENSEETKLKAGNS-TAGSEPESSSYRENCRKRKMSSKD-SCQDTaGN-CPEKECSLSLNKKSRS---STA 131
gi 359318757  61 SEPE--TDE-ENSKETELKRHSS-SSGSELEGCSSWEGSRKRKISSSDsTCDGA-GA-SPADEGSVTPGKKKRRa--SDH 132
gi 528993230  74 SEPE--MDEkDNSKENETQDRNRhTAPSDSERGSSSESSRKRKIDSRNrTCDGT-GA-SP-HEPSVTLENKKRKv--LES 146
gi 444728660  24 SEPElsPDEeKSSQESELTARHS-ISQSESESSSDEGRSRKRKASSGD-SCQAQpGNyEPGDEDGETLEKKRKPsvgLDG 101
gi 564317281  32 SEPN--KNErTPSQSDS-------NSSNHTEESTQKEAPRKRKHSSRDsSQVRT-GS-EG-------------------- 80
gi 281339219  62 SEPK--TDE-ENSKETELKRDSG-ISGSESESCSSWEDSRKRKISSGDsTCDGA-GA-SLAHERSVTPRRKKRRa--PGE 133
gi 431897966  61 LEPE--TDKeENSKETKFKGRKScIAPSEAERCSNRESSRRRKSRSRD-SPRATaGA-SLGEERSVTLEKKTRKv--PDA 134
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74708395  132 VHNSEIQETCDAHHRGHSRACTGHSKRHRSRALGVQTPSIRKSLVTSVRAMSEAVYQDLAQVWAQQIHSPLTCEQLTLLT 211
gi 359318757 133 GRSSESQGTAPARPGRRWARGSGRSRRGRHSPRGDRPPPLRKALVTTLRALSEAIYQDVAQVCELQKHSPLTWEEQFGLG 212
gi 528993230 147 GRSSSSEKTRAPRSRRPHPRRPGRSQRPRSRSPEDQLPPLRKSLVTSLRYMSEAIYQSIVHMHKQPGYSPQCWQQ---LA 223
gi 444728660 102 RSSSEGQPTRGAHSSGPLRAGSGRPNQPRSRSPGGRPPPLRKSLVTSLRTLSEAIYQDMAQVWAQQAHTPLTEEQLAELA 181
gi 564317281  81 --SSHGKKRHKTSETKAEPRANGHQDGLSHRPQHTDPLPIRKNLVSFLREKSEEIYRDTVQMQAQQHGSLLSPEQLSQLS 158
gi 281339219 134 DRGRESQEPADARLRRRGAPGAGRGRRSRCRSPGVRPPPLRKRLVTTLRALSAAIYQDVARACERQKHSPLTREQRAGLA 213
gi 431897966 135 GHSSDCETTPDVCPRRAQRRRTGCSKRPRSRSPGVQPPPLRKCLVTSLRAMSEAIYQNMVRVQNQRVPSQLSGEQLSMLS 214
                        170       180       190
                 ....*....|....*....|....*....|
gi 74708395  212 RLRGPLCAQVQTLYSMATQAAYVFPAESWL 241
gi 359318757 213 QLWGPLYSALQTVYTMANQAAYAFPAESWL 242
gi 528993230 224 QLREPLWAAAQTIYTMANEAAYAFPAEGWL 253
gi 444728660 182 QLRGPLHAAVQTFYAMARQAACTFPAEGWf 211
gi 564317281 159 QLSGSLTAVVHTFYSMATQAGFAFPAEGWL 188
gi 281339219 214 GLGGPLYAALQTVYTMANQAAYGFPAESWL 243
gi 431897966 215 QIRERLCAQVQTVYTMATQAAYVFPAETWL 244
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap