Conserved Protein Domain Family
TALPID3

?
pfam15324: TALPID3 
Hedgehog signalling target
TALPID3 is a family of eukaryotic proteins that are targets for Hedgehog signalling. Mutations in this gene noticed first in chickens lead to multiple abnormalities of development.
Statistics
?
PSSM-Id: 317697
View PSSM: pfam15324
Aligned: 9 rows
Threshold Bit Score: 1301.36
Threshold Setting Gi: 426021202
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426021202  125 EDVQISTFSADGRGVVSAALRKRSQGAPIRRNVTVQVLDQDRSQTP----AGVQPDPAfplgDPGTSASVAAITAATLAA 200
gi 327478601  100 NDIFISQYTMGQKDALRTVLKQKAQSMPVFKEVKVHLLEDAGIEKDav-tQETRISPS----GIDSATTVAAATAAAIAT 174
gi 637351859  126 aDIFISQYDAGQKEAVRAVFKQRVQNAPVFKEVKVQLLGNTCSNKK----DSPKSSHS----EMDSAATIAAATAAAIAS 197
gi 823461656      --------------------------------------------------------------------------------
gi 148704605  121 NDIFISQYTMGQKDALRTVLKQKAQSMPVFKAVKVHLFEDTSTEKNtv-aQETETPPN----RIDSATTVAAATAAAIAT 195
gi 884922270  114 DDIFISQYSVGQKDALRTILKQKAQSIPIFKEVKVHLLDDAGVEKVaa-pPEARGSPS----GIDSATAVAAATAAAIAT 188
gi 821454924  131 NDIFISQYTTGQKDVLRAVLKQKVQHSPTFKEVKVQLLKDACMVKDpi-sVEKKLSSN----GIDSPSTVAAATAAAIAT 205
gi 620988190   95 kDISIFQYSVGQKDLLRAALKQKAQNGPVPKEVKVQLLEDARPGKDapeaQRPGPSPA----GVDSASTVAAATAAAIAT 170
gi 972978279  118 hDIVISQYSVGGKEAVRAVFKERCRSAPVRKAVKVQLLEPQEP-------PPAGPPPP----QPCTADTVAVVTAAAIAA 186
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426021202  201 TAPLMKAQSEMEAQISRVSAELKRLQAAEGSVPPGRTARTDSSSa--------GRaahlEEQLNILIQQRLQHLETIQCQ 272
gi 327478601  175 AAPLIKVQSDLEAKVNSVTELLSKLQETDKHLQRVTEQQTSIQRkqek-lhchDH----EKQMNVFMEQHIRHLEKLQQQ 249
gi 637351859  198 TAPLLKVQSDFEAKVSSVSKILNKLQETDRRLQLAVERQSSLKAptrerspchQRfgelEKQMHLFMEQRLRNLENFQQQ 277
gi 823461656    1 -------------------------mhetiytlleaptvpfriglswnsgvlstkaypecllpvenskpmflsqmdppge 55
gi 148704605  196 AAPLIKVQSDLEAKVNCVGELLTKLQETDKQLQRVTEHQASVQSkqek-vhchDH----DKQMNAFMEQHIRHLEKLQQQ 270
gi 884922270  189 AAPLIKVQSDLEAKVNSVTELLNKLQETDKHLKRVTEQQTSIQNkqek-lychDH----EKQMNVFMEQHLKHLEKLQQQ 263
gi 821454924  206 AAPLIKVQSDLEAKVNSVSELLSKLQETDKQLQRVAEQQKNIKIqpek-sccqDH----EKQFDVFIEQHLRRLEKIEQQ 280
gi 620988190  171 AAPLIRVQRDLEAKVNSVSELLGKLRETDRRLQRAAERQAGVSErrrerdssrDL----EEQRNASLEKHLRHLEKLQQR 246
gi 972978279  187 TAPLLKAQHDLDTKISSVSELLKKLQHVERQpc------------------qeERvaelEKQLAALTHQRLQHLEQIQQQ 248
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426021202  273 QIQLQNRLLGSALDVVAs--RGNSSGVSqtdslplqisgnrsirlSATDNPSAGRPASVSMd------------------ 332
gi 327478601  250 QIDIQTHFISAALKTSS---FQPVSMPSsrav----------ekySVKPEHPNLGSCNPSLyntfask--------qapl 308
gi 637351859  278 QMNIQSHLISSALNPGG---LQAASTAA-----------------SKETTKPTAGRSLASQtsppqdllaaravhmqacs 337
gi 823461656   56 aavqddplvlledsrepeddvfisqyatgqkealraalmqktqvipvhkevkvqllgsastekregagddtrsapreaes 135
gi 148704605  271 QIDIQTHFIDAALKASS---LQLGMSTSrav-----------gkySGKLGSPSVGSSVFSHntfvsk-----------rv 325
gi 884922270  264 QIDIQTHFISAALKTNT---FPPASTLApram----------ekhSREPGCPFVGGSMLSShepfask--------qatl 322
gi 821454924  281 QVDIQNHLIASAFNSGR---YQPVIVPSsnpve--------ksfvKSELQCP-VGSNYTSHhrctelp-------sqayl 341
gi 620988190  247 QLDIQTHFISSAFRTGSgpnLPPAAASPpapleky---pleqravERESRRPLSNSDRHPGseat--------------- 308
gi 972978279  249 QLELQTRLLGGALSAVSgssAPAPPVSShlaapaqp-glqrlpgnASRDESPAGAPASTSTaaagcpp------------ 315
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426021202  333 -vYRE---------RQTGGHKSPLETPAPRKVIPKPTHWTSSTSTN----RPPKSsf---------knQGNGRLQDQSPN 389
gi 327478601  309 keVED---------TSFDKQKSPLETPAPRRFAPVPVSRDDELSKR----ENLLEekenm---evschRGNVRLLEQILN 372
gi 637351859  338 rpFGS---------HAVHRQKSPLNTPAPRRYAPVPVSRDAKISQKmskrEPPVGekenmhqpaygttVGGGKLLEQILN 408
gi 823461656  136 attiaaataaaiattapllkvqndleakvnsvsellqklqetdrqlqraseqqkkvkaqheeppfhqrVSEGKGLEHVLN 215
gi 148704605  326 plseD---------TDFDGQKSPLETPAPRRFAPVPVSRDGKITKR----ESPTEekenm---emnspKGNVRLLEQVLN 389
gi 884922270  323 rkVED---------TYFDEQESPLETPAPRRFAPVPVSRDGEMPKR----ENPMEekenm---eksdyKGNTRLLGQILN 386
gi 821454924  342 rqVKD---------LGFDNQKSPLETPAPRRFAPVPVSKDDKISKN----AKPREekenl---qilscTGNGRLLEQILN 405
gi 620988190  309 dpsaGegcprptagLGRDRVESPLETPAPRRFAPVPASRDAGISWR----EHPAAekeds---htpapRGGMSLLEEILN 381
gi 972978279  316 -------------prvpaaeTSPLETPAPRRFVPVPMSRDAAARRSq---EKPAVekskv----asgrLGSGRLLEEILN 375
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426021202  390 NRRSPERCALQSVgVERFAMA-------TADnSQPEQS-------R--------EsqmpskasVTRSAqedgssfvngqn 447
gi 327478601  373 NNDSLTRKSESSN-TTSLTRS-------KIG-WTPEKT-------N--------R--------FPSCE------------ 408
gi 637351859  409 SQETPASQDTYSL-KESSGNN-------AVL-WPFERE-------C--------RssvqepepFCAFKst---------- 454
gi 823461656  216 SQETPLKQVEYSK-KAALNSN-------ERS-WHSERHrhkalppD--------Aiss---------------------- 256
gi 148704605  390 SNECLTRKTESSD-ITSLTQP-------KMG-WNLEKR-------D--------StetlhsqiFPSSE------------ 433
gi 884922270  387 NNDSSTRKSESSD-ITSLSRS-------KLG-WNPERR-------HsfealssqR--------FPSSG------------ 430
gi 821454924  406 SQDTQVKESTSSE-GVSLATS-------RIK-QDPLRD-------S--------GvaplkpnsFPSHE------------ 449
gi 620988190  382 NQDSSEKSALSRPkLGCYPQRsgfaepsRVA-TQPNKS-------------------------FPSRE------------ 423
gi 972978279  376 TQ------GLQSArGRSVTMA-------TGG-SYTERN-------S--------Csrk---------------------- 404
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426021202  448 eqerqgeptNVSSSSTTVQKASEMLQDLGRLKNEMRSLLqtadafpvp--------------nakstqssR-----S--- 505
gi 327478601  409 ---------ELETTKVTMQKSDDVLHDLGQKEKETNSMV-------------------------------Qp----K--- 441
gi 637351859  455 -------nqNLNPVERTVQKAGDVLRDLGQLKREMHDILqdakewksdmnkfmkttahpgeaiqakdrlpQs----Q--- 520
gi 823461656  257 -------feSYSSIEKTVQKADHLLQDLGKLRREMHNIL-------------------------------QeattwK--- 295
gi 148704605  434 ---------ERGTAQVPVPKYNDVVHDLGQ-KKQASDML-------------------------------Qi----K--- 465
gi 884922270  431 ---------EPGTAIVTVQKPNDVLQDLGQKRKETNSVL-------------------------------Q--------- 461
gi 821454924  450 ---------EFGIAEKTMRHTDDVFYDLGRRKKEp-----------------------------------------E--- 476
gi 620988190  424 ---------ELGAAGRTAEKASDLLRDLGQLKREMNGIL-------------------------------------Qeak 457
gi 972978279  405 ---------aeEAASAAVKKASDVLRDLGQLKTEMQSLLqegkewrsnleqqskvpevfplewsrqarpnRg----P--- 468
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426021202  506 -----------------------------RHLAPVATA---PP------------PatapismppepvdviavraaalNR 541
gi 327478601  442 -----------------------------ESLSMLKLP---DL------------P----------------------QN 455
gi 637351859  521 -----------------------------SSSSLLPSS---EA------------FlpmpppaenytvaptlrelqqlSK 556
gi 823461656  296 -----------------------------SDMNDLIKA---KNppvapdppehhlV----------------------SK 321
gi 148704605  466 -----------------------------QSPVTLRLS---DH------------P----------------------HN 479
gi 884922270  462 -------------------------------------------------------------------------------S 462
gi 821454924  477 -----------------------------ESLNTVRVD---DL------------P----------------------KS 490
gi 620988190  458 lwksdmkdfikqkdcpgpsrhpdpgpprhPDPGPSRHPdaiLE------------P----------------------QG 503
gi 972978279  469 -----------------------------AASDPPPPP---PP------------Pppaplegslh--plksaslpqsSD 502
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426021202  542 ASVLKSIQPPTSMFEDAGLVLRQVRQSKKTLEENLEAILRAKDGEVLHTQLEALSKNRDVREELRIKKTVDAWINTLSKE 621
gi 327478601  456 SVKLQTTNTTRSVLKDAEKILRGVQNNKKVLEENLEAIIRAKDGAAMYSLINALSTNREMSEKIRIRKTVDEWIKTISAE 535
gi 637351859  557 SSILQSTQASKSILRDAEKILRAVQKNKKLLEENLEAIIRAKDGNALHAFIDGLTADRDVLEEIRIRKTVDEWIKAISME 636
gi 823461656  322 PSILQNIQVPRSILTDAERILRGVQNNKKVLEENLEAVSHAKDGDAMYAFSNSLTTDRDVLEEIRIRRTVDERIKEISEE 401
gi 148704605  480 PALLQTTN-TRSVLKDAAKILRGVQNNKKVLEENLEAIVRAKDGAAMYSFINALATNREMSEKIRIRKQVDEWIKIISAE 558
gi 884922270  463 SCKLQTTN-TRSVLKDAEKILRAVQNNKKMLEENLEAIIRAKDGAAMYSFINALSTNREITEKIRIRKTVDEWIKAISAE 541
gi 821454924  491 PKHLKSTKTARSILKNAEKILRGVQNNKKVLEENLEAIIHAKDGAAMYSFINALATNREMLEKFRIRKAVDEWIKIITQE 570
gi 620988190  504 PGRFQCTRAPESIVKEAARILKGVQNNRKVLEENLEAIVRARDGTAMYSLISSLAASSDAVEEVRIRKTVDEWIKAISME 583
gi 972978279  503 PMVLQKTKAPKSMFEDAEKVLRQVKQHKKVLEENLEAILRANDGAVLHSQIEALSSNRDASGEIRIKKTVDEWIGTISKD 582
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426021202  622 IQDDLARESserivdaaVSRREAGQRTRAEA-SAAAkktsvraqAGNTRAHTRQPAPAV----------RNKP------- 683
gi 327478601  536 IQDELSRTD--------YEQKRFDQKNQRTKkGQNM--------TKDIRTNTQDKTVNK----------SVIPrkh---s 586
gi 637351859  637 IQDEMERTD--------SLKRQQASQMARTSrEIMG------------KSHYPSKVPTK----------RPLPatkp--i 684
gi 823461656  402 IQAEMARNY--------SERGKHDQKCTKRAqNLRA---------VKTKKETKEKTQNXpgcltkkllpAAKPlq----- 459
gi 148704605  559 IQDELMRKD--------YEQKRFDPKNQRNKkALTM--------SRDIKANNQEKTVNR----------SVIPrsh---y 609
gi 884922270  542 IQDELARKD--------FEQRRFAQKNQRTQkAQIM--------SKDIKANTQDKTVNK----------SVILkkp---- 591
gi 821454924  571 IQEELSRKD--------YEQKKFD-KNRRSNfTKKAlnnqyqktSKEIKISAQDKNLNR----------FGFPgkh---f 628
gi 620988190  584 IQDEMARND---------ERKKLHRKTERVTlAEKTqilqhskvKKKGTADPSSKTGFS----------GTFPq------ 638
gi 972978279  583 IQAEIARKDf-------VSQMKGKDKEAATVsSQKGqgakgirqQRDVKNAAQSKLITA----------ARKPlntskpf 645
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426021202  684 --AVKQEATQPIVL----------------------KSQDDEEYLARLYGKAIYDGQRRTLKKSPYLRFNSPTPKSKPQR 739
gi 327478601  587 qkQIEEHFRNLPMRgmpasslqke---rkegllkatTVIQDEDYMLQVYGKPVYQGHRSTLKKGPYLRFNSPSPKSRPQR 663
gi 637351859  685 qrLTDKVLPKTRLE------------------------LHNEDFLSQVYGRPIYQGHRSTLKRSPYLRFNSPPPKSKPPR 740
gi 823461656  460 -kEVEDNTRKQKFRiyfsenvkske-rradgavggtTLTQYEDYLSQVYGKPIYQGHRSTLKKGPYLRFNSPSPKPKLPR 537
gi 148704605  610 qkQTQEQFTSPPVRnlpasgpqk----ersgllksaTTLQDEDYMLQIYGKPVYQGHRSTLKKGPYLRFSSPSPKAKPQR 685
gi 884922270  592 qkQVEDYFRSPPARsmavsslqke---rkagplkspTMIRDEDYMSQVYGKAVYQGHRSTLKRGPYLRFNSTSLKSKPQR 668
gi 821454924  629 rkQLEESYRNTYLQnicisnldkn---rkeghlkttKVAQDSDFFLQIYGKPAYQGHRSTLKRGPYLRFNSPSAKSKPQR 705
gi 620988190  639 -nRTENRASHQNWRgfsvsqnsqkreerneglrkpaAADQREDYLTQVYGRPVYQGHRSTLKKGPYLRFNSPSPRSKPQR 717
gi 972978279  646 rkAAEGHLEKPNVQsksfshflq-----kkepilkgQELEDEEYLQRVYGRAVYQGHRSTLKRAPYLRINSPSPKSKPQR 720
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426021202  740 PKIVETVKGVKMKSSKTQTSQY----VGDvsAMQHSV-----SEPHFIFSPSDPDKQQqqpGSPVRGYLIPMAIPLGKPR 810
gi 327478601  664 PKVIERVKGTKVKSIRTQTDFYatkpKKMdsKMKHSVpvlphGDQQYLFSPSREMPTF---SGTLEGHLIPMAILLGQTQ 740
gi 637351859  741 PKVIESVKGTKVKSARTQTSDHvh-sNATrpDKPHLSta-lrQELQYLFSPIKEGPSS---SGPLEGHLIPMAIPLGQKQ 815
gi 823461656  538 PKLIETVRGTKVKSARTQTCSHtq-qVISspRKKNPVy---aQQSQYLFSPSQDIPAA---SGPLEGHLIPMAVPLGQTQ 610
gi 148704605  686 PRVIELVKGTKVKSAKTQTDFHaasrMKMdsKIQHPItalphADQQYMVSPSREMPTV---SGTLEGHLIPMAILLGQTQ 762
gi 884922270  669 PKVIEQVKGTKVKSIRTQTDLHatkpMKTdsKMQHSIpalphGEQQYVFSPSREMPTF---SGTLEGHLIPMAILLGQTQ 745
gi 821454924  706 PKVIEQVKGTKVRSTRTQTDLEmtrpVRTdsRKPHSCslpthQEQQYLFSPSREMPSV---SGTLEGHLIPMAILLGQTQ 782
gi 620988190  718 PRVVERLKGTRVRSAKTQTSSRpprsVAMspKRHRALpvprlQDRQYLFSPSREMTSL---TGALEGHLIPMAVPLGKTQ 794
gi 972978279  721 PRVVESVKGIKVKSARTQTGLFppkkTDSrpAGQPFS-----HELDYVFSPSRDVPSTgirSAPLEGLLIPVAIPLGVPR 795
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426021202  811 VDCQPPVPSRVIITD-KPAIVTTSFP--PITvveSKPTPAIRKPNAILLEVQSAPKKRtPQLQIQVQPGVNIESAlcssr 887
gi 327478601  741 SNSDTMPPAGVIVSKpHPVTVTTSIP--PSS---RKVETGVKKPNIAIVEMKSEKKDP-PQLTVQVLPSVDIDSIsns-s 813
gi 637351859  816 IDSIPPQPAGKSIGEfHPLTVTTSVP--PSHpplQKPEPKAKKPNIAVIQMRSEKKDP-PKLTLQVLPSVDIDSIssgsr 892
gi 823461656  611 SSNTSLQTAGVIIDKpHPITVTTSLPqvP-----PKPPVEVKKPNIAVIEMRSEKKDP-PQLSVQVLPNVDIDSVssasg 684
gi 148704605  763 SNSDSMPPAGVTVNKpRPVTVTTSIP--PAS---RKGNAGVKKPNVAIVEMKSEKKDP-PQLSVQILPSVDIDSVsysst 836
gi 884922270  746 SNSDSLPPAGV-VHKlHPVTVTTSIP--PSS---RKVETGVKKPNIAVVEMKSEKKDP-PQLTVQVLPSVDIDSVsns-s 817
gi 821454924  783 SNSDSMPPAEAVVEKpHLVTVTTSIP--PSI---KTKPTGPKKPNTAVIEMTSEKKDP-PQLTVQVLPNLDIDTLsnesa 856
gi 620988190  795 SDRVSPHPLGVVVGEpHPVTVTTSIP--PSV---PKARFAVKKPNVAVFKVKSQKKEP-PQLTVQVLPNVDIDSIsngsv 868
gi 972978279  796 LDGAAPQPSSVTTVQkQPVTVTTSVP--PCP---PKPPAGARKPNVALLEMRSEKKDP-PTLTVQVLPSVDINSVss--- 866
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426021202  888 qaSPTPvIPAESILPPPSIHATEDPHA--HEDQQE-NIFPGTNFLAQADISQ----ETNG-GLP---DSPIEFKGLPSPP 956
gi 327478601  814 adVLSP-LSSPKEASLPPVQTWIKTPEimKVDEEE-VKFPGTNFDEIIDVIQe--eEKCD-EIPd-sEPILEFNRSVKAD 887
gi 637351859  893 svNQASsTSLP--------EKAMSSPDgsLLQDED-LHLPGAHFDG-TDVSQd--eGVEDfGIPefaEPVLEFNRQGETE 960
gi 823461656  685 svSLVPpGSEPL---LPLVNAVIQAPEeiHSEEED-TKLPGANFIDVTDVTQdqeeEKDE--FPeilEPLLELNGQFKVA 758
gi 148704605  837 dgASSP--PSPKEASLPPLHTWIQTPDfmKVDEEE-VPLPGTNFDEVIDVIQe--eEKRD-EIPecsAPMLEFNRSVKVV 910
gi 884922270  818 apSSLPfLSSPEGAPFPLMRMCTQSPEfmKANEEE-VKFPGSNFDEVIDVIQd--eEKCD-EIPeysEPILEFNRSVKVV 893
gi 821454924  857 deNQAS--TNCIEASHP-TQTWIQVPElnQPDEDE-PKFPGSNFDEVFDVIQd--eEKSD-DIEdffEPVLEFNQSAKVI 929
gi 620988190  869 eaSEMS--PSPGGA-LGSVRVHTRAPEfsQP-EDD-LHFPGTNSDEMIHLGQd--lEKED-ESPpcaEPILEFENCARVV 940
gi 972978279  867 ------esPAPS---PPLAQPNIQTVEqaQTQEEDsNEFPGTDYVAVTDIAQd--sEEEDgl----sEAAIEINGQVGPA 931
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426021202  957 ADLYHGPVFPPVPTQSTPLTEPILNTIQQRETLENRLVDWVEQQIMARVITGMFPQP-AQADPVH----QSEPENSVASD 1031
gi 327478601  888 STKYNGPPFPPVASTFQPTADILDKVIERKETLENSLIQWVEQEIMSRIISGLFPVQ-QQIAPSIsv-sVSETSEPLTSD 965
gi 637351859  961 SPKYNGPPFPPAVPVPQVSSDVLDEIIEKRETLENKLVDWVEQEVMARIISGMYPTQ-KEAVPDLna-sESEHSEAVSSD 1038
gi 823461656  759 SPQYNGPVFPPVASVPQQPADILDELIQRRETKENELINWVEKELMAKIISEMCPAQ-TERMPSIsssiKSEDSETVTPG 837
gi 148704605  911 PTKYNGPSFPPVVSAYHPTTDILDKVIERKETLENSLIQWVEQEIMSRIISGLFPLQ-QQARLDAsv-sVSEASEPSASD 988
gi 884922270  894 STKYNGPPFPPVLSTAQPTTDILDKVIERKNTLENNLIQWVEQEIMSRIISGHFPVP-SQTKLPAsi-sVSEASEPSTPD 971
gi 821454924  930 PQHYNGPPFPPVVSAAQPTADILEKVIEKKEALENSLINWVEQEIMSRLISRMLPFQ-PQTVPNVsv-sESEESETSASD 1007
gi 620988190  941 ARQYEGPPFPPVAPAPQPSADILVRVIERKETLENKLINWVEQEIMGRIISGLYPLQrRQAVPDVsr-sESEGSGALTSD 1019
gi 972978279  932 LAPYHGPSFPPSAPEPRPTIDAVEVRIQQRETLENRLVDWVEQQLMARVIAELYPPR-VQAAEDSga-sELEDSGASTSD 1009
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426021202 1032 IVEAAGGSGLQLFVDTGVPVDSEVIRHYVNEVLTEIIASMLGQREAQGTPA----TLVQTQDAQKEDTTVP----TPAPT 1103
gi 327478601  966 IVEGTSSGALQLFVDAGVPVNSNVIKHFVNEALAETIAVMLGDREAKKQGPv---ATGVSGDASTNETYLParvcTPLPT 1042
gi 637351859 1039 IVEAAGAAGFQLFVDAGVPVDSEMIRRFVNEALAETVATVLGDRENHRAAPvt-vVPSAAALLPEKETLLP----TPLAT 1113
gi 823461656  838 IVEAAGGGGFQLFVDAGVPVDSEMINHFVKEALSETIATMLGDSWAQRAVP----DPLPPSTTSVMEAPLP----TPVPT 909
gi 148704605  989 IVAGTSSGALQRMVDARVPVNSDMVSHFVNEALTETIAVMLADREAERQRAa---ATSVPGDLSGTETNLLarvcAPVAT 1065
gi 884922270  972 IVEGTCGGALQLFVDAGVPVSSGTIRRLVNDALAETIAGMLGDRESKKESPv---AAGVPGDVSTSETLLLtricTPVAT 1048
gi 821454924 1008 VVEAAGGTKFRLVVDAGVPVNSDMINLFVNEALEEIIAIMLGNKEITKDVP------PLPANVPDNVTYLPtvhhTPVPT 1081
gi 620988190 1020 IVPMAGGGGVQLFIDAGVPVSSDTIGRFVNEALAETVAAMLGARESRRPAApagvASWTPTW--DSAST------TPGPT 1091
gi 972978279 1010 IVEAAGGGGVQLFVEAGVPVDSELIRQYVNDALAETIAIMLGQREGQRPASp---PAALEVPAPPKEPVVP----TPVPT 1082
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426021202 1104 PEPSLKD-----PP------SPVRTPDLSEHLSTA----TSPEKPPQE-----SASpGP---DRIPVGTPITTPIPSPTR 1160
gi 327478601 1043 PQPTPPCs----PSspakecVLVKTPDSSPCDSDHdmafPVKEICAEK-----GDD-MP---AIMLVNTPTVTPTTTPPP 1109
gi 637351859 1114 PEATPPQs----PPpalneqFPVKTPTSSPSVTEMdgeqP---------------QtGPeaaAASVVYTPVATPVATPPK 1174
gi 823461656  910 PQATPPPt----PPsek-elPQVKTPDSSPSPPEMngdvHGHEKIKETgveiaAAT-GP---VVTPVVTPVVTPVTTPSP 980
gi 148704605 1066 PQPTPPCs----Pspv-rehVRVKTPDSSPCESDPdaasSIKEIRVEK-----GSD-MP---AVMLVSTPTRTPVATPPP 1131
gi 884922270 1049 PRPTPPCs----PSsppkecVLLKTPDSSPCGSYHdvtfPVKEISAEKer-svGQD-IP---AVTLVNTPSVTPTATPPL 1119
gi 821454924 1082 PQPTPPQs---pPPsslkepLLIKTPEASPCVSEHdi-fPVKEQFTQT-----GTDnLP---ASTLIITPTVTPAATPPL 1149
gi 620988190 1092 PQPTPPPshsrsPSsqekepSPVKTPESSPCPSERggviPSRERAAES------------------VRTPTVTPAATPPP 1153
gi 972978279 1083 PQLSPHPs----PPpsgrapSPVRTPDVSERESAAe--fSEAELEPSA-----PVHtEPeeeHKSPVITPAATPIPSPHP 1151
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426021202 1161 VAT-PSPPTpan-----qspEPGSLqiHLWEGSELPLEEEE----QPE-LQP-APVVISVPRvDDQEESVIHPS--SPVL 1226
gi 327478601 1110 AAAvFTPTLsdisidklkvsSPELP--KPWGDGDLPLEEENpnspQEE-LHP-RAIVMSVAK-DEEPESMDFPAqpPPPE 1184
gi 637351859 1175 IAT-PTPPVserapnreameKPPPP--NPWEDAELPLEEEKpspqSEEgAYPsRAVIMSVAK-HEEPDSLVLPA------ 1244
gi 823461656  981 AAT-PSPPAsewdsqaekrqSPKLP--NPWDGAELPLEEENpspvPEEpFCP-QTVEMSVAN-DEEPEALVFPSqqLP-- 1053
gi 148704605 1132 AAA-LTPTLsetsidklklsSPELP--KPWDSGDLPLDEENpnslQEL-PHP-RAVVMSVA--NEEPESVDFSAqpAPPE 1204
gi 884922270 1120 AAA-LTPTLsetsidklkisSPELP--KPWGDRDLPLDEENpnsfQEElLHP-GALVMSVAK-DEEPRSMDSPAplTPAE 1194
gi 821454924 1150 AGT-PTLTLsenssenlkrpSPKFP--KPWSTDDLPLDEENpnpiQEEvLHP-RAIVMSVAR-DEEPENLVLPIpsSSPN 1224
gi 620988190 1154 ERSsASPPMp----------VPEAP--KPWGDADLSLDKENpssfTEEpRYP-RSVVMSVAK-DEEPEDLIPPA---PRD 1216
gi 972978279 1152 VAT-PSPPEpern----pspEPARPlpSSWEDAQLPLEEEDprpdREE-QQSqRAVVMSVAQ-EEETVSLVTPS------ 1218
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426021202 1227 SKPQSPP----APP---LPPviqksessSSSSSSSSESSCSSS-VTVTETETAARHISEGELLLNHGQMAAVRVLEQEG- 1297
gi 327478601 1185 PVPFMPFpagtKAP---SPS--------QMPGSDSSTLESTLS-VTVTETETLDKPISEGEILFSCGQKLAPKILEDIG- 1251
gi 637351859 1245 SVPIAPQdlqsQEPrarSPSv-------QSPSSGPSTEES----LTTTETETTDKPISEGEVLYSYGQLLAVKALAEGG- 1312
gi 823461656 1054 GRPFEPLlcsaLVP---SPV--------PTVSSGVSSQESS---LTPTGTETTDRPLSEGEVIFSYGHPLPAAALAEGG- 1118
gi 148704605 1205 PAPSAPLpegtKAP---SLQ--------RVPSSGSSTLENTLS--TVTETETLDRHISEGEILFSCGQNLATKRPGD--- 1268
gi 884922270 1195 PPPLTQLpvcaEVP---ASL--------QVLSSSSSTLESTLS-LTITGMETLDRPISEGEIVFSCGQRLAPG-ILEGGe 1261
gi 821454924 1225 PIIFRSFpleaRVP---SPV--------NTPSSDQMTQESSSSyVTTTETETVERPISEGEILFSYGQKMATRDTSDGG- 1292
gi 620988190 1217 AVLVNPPpvgpRTP---SPA--------PAPSSSPSTQDSSSS-TTFTESETLDRPISEGEVIFGTEHTVAARAVAEEE- 1283
gi 972978279 1219 -PPVAPQaptpTPP---PPLqapptateTPPPPTPSTEDSSST-ASVTETDTAGRNISEGELLFSYGQLAAARALAEGG- 1292
                        1450      1460      1470      1480      1490      1500      1510      1520
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426021202 1298 VLLPNFMTSLNGSLHGVQDMDYDPPSEGQV-IRAPHLPAHHDPVLSlLARMELGPISQSQ---QPEgwwEEESS-GEVSE 1372
gi 327478601 1252 LYLTNLNDSLSSTLHDAVEMEDDPPSEGQV-IRMSHKKFHADAILS-FAKQNQESAVSQQavyHSE---DLENSvGELSE 1326
gi 637351859 1313 LSLPNLSDSLASSLHDAQEMDYDPPSEGQV-LRRPHKGYHRDTVLSlFSKLNQAPLASQEeicRSE---NTDDSaGELSE 1388
gi 823461656 1119 LCVPNLTESLSSTLRDANEMDYDPPSEGQV-VRRRDKGCHRDPVLAlLTKLHQAPVYVQEridHSE---DSDGSiGELSE 1194
gi 148704605 1269 LFLMNINDSLSSTLQDALEMEDDPPSEGQV-IRRPHKKRHEDAIVAlLTKQQRELLVSQQ----EE---DLDNSvGELSE 1340
gi 884922270 1262 LYLTNLNDSFSSTLHDALEMEDDSPSEGQV-IRIPHKNFHTNEILPlLAKQNQELQGSQQavyHSE---DLENSvGELSE 1337
gi 821454924 1293 LFLNNFNDSLSSTLHDAHEMEDDSPSEGQVmMKRPHKEYHQDIFLSlLAKLNHGSLDSQQvvyHSE---ESENStDELSE 1369
gi 620988190 1284 LSLTNLNDSSGSTLHDAHEVDDDPPSEGQV-IKRPHEGFHRDPILSlLTKLNQGPVASQQpvcHLE---DSENSlGELSE 1359
gi 972978279 1293 LTLPNLSASLSSSLHGFQDMDYDPPSEGQV-IRRPDIQHHRDPVLSlLARMNQGLTALQEghvHPQihsDDDSSmGEVSE 1371
                        1530
                  ....*....|....*.
gi 426021202 1373 GQRPVLTAAEEIVLTG 1388
gi 327478601 1327 GQRPQLTAAAENILMG 1342
gi 637351859 1389 GQRPRLTRTAESILMG 1404
gi 823461656 1195 GQRPRLSRALERILMG 1210
gi 148704605 1341 GQRLVLKAAED---IS 1353
gi 884922270 1338 GQRPRLTAAAKHVFLG 1353
gi 821454924 1370 GQRPRFPAAKENIFMR 1385
gi 620988190 1360 GQRPRLTAAAESLLMG 1375
gi 972978279 1372 GQRPRLPAAGETLLTG 1387
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap