Conserved Protein Domain Family
TEX15

?
pfam15326: TEX15 
Testis expressed sequence 15
TEX15 is a family of eukaryotic proteins that is required for chromosomal synapsis and meiotic recombination. TEX15 regulates the loading of DNA repair proteins onto sites of double-stranded-breaks and, thus, its absence causes a failure in meiotic recombination. Two polymorphisms in the TEX15 gene could be considered the genetic risk factors for spermatogenic failure in the Chinese Han population.
Statistics
?
PSSM-Id: 317699
View PSSM: pfam15326
Aligned: 10 rows
Threshold Bit Score: 376.443
Threshold Setting Gi: 821490143
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 998490985 1574 KER-KEAGQIKVNNNSHSD--------CLSKP--AI-VETNHRPVLHGNPKVATLQ-----------K--E-----LKE- 1622
gi 612029004 1975 RTKeKEGGGQMEAEDGPTLstitpqatMLGDP--AIrKKVPQTRVRKMHSRIPEAE-----------PtrQppptsELEa 2041
gi 821490143 2805 KKArHQEGRIEVGNEPALSstal-patGMGDPvcRW-KGASQMSIMKMHLGIPEAT-----------P--Aq---qPEEg 2866
gi 351715430 1522 NKR-KRKGKRKVSNDCQSG--------YISKP--GI-LEIDHRPILHAHSETSEVTiqkp---tsyeN--E-----LKEn 1579
gi 731490157 1551 RTRrEKGGKVKATSDSQPDsiapseitCNFKP--GV-TEINHKPIPHAYPEVFEVTalqkk-ptsylN--E-----LKEk 1619
gi 655605478 1930 KKRkEKEGEIRSSNHPQSD--------YISQP--SI-LEINHMPVSLAHSETSEVItlptk-ptlytS--D-----LIEn 1990
gi 15021846   364 NKR-EK-AEIKVTNDSQSDltlhseiaYISKP--GI-LGVNHTPILPAHTETCKVTtllkk-pasymS--E-----LKEk 430
gi 395847409 1528 NKR-EQKGKIKISSDSQSDstlhsettNISKP--DI-LGIHSMPVLHAPSETSKVTtcqks--tsyiN--E-----LNEk 1594
gi 803200311 1944 NKRkEEEG--RVSQDSQYDsslhsevaCDSKP--GI-TGRNHMPHLRGQSEPPKVSppppkkstsymN--E-----FKEk 2011
gi 281347426 1560 SKR-EKEGGVKVNNNSQSDsalyseiaCNSKP--GI-IGMSHRPVLHMHSQTSGAStpqkk-ptsnmN--G-----LREk 1627
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 998490985 1623 HRSPNYTSHVTELSQILQRADEAASLQILEEETKLCQNILPLFVQAFERQQECSIDQILISRKLLVEQNLWNNCRLKLKP 1702
gi 612029004 2042 RPEEDPPTLILKLSRILQKADEASTLKSLQEQIDTCQAVLPLFIEAFERKQKCSFKHILISRELLVEGNGWNNCKHHLHP 2121
gi 821490143 2867 HSSKDPTTFVVKLSRILQKADKSSTLKSLQGQVKTCQTVRPLFIETFERKQKCSFKHVLISRELLVEGDGWNNCRHCLHP 2946
gi 351715430 1580 HCSVTQTALVTELSQILQRADEASSLEILEKETKTCQNILPLFVEAFERKQECSLEQILISRELLVEQNLWKNCKYKLKP 1659
gi 731490157 1620 HGTANHAGFLAQLSQILQRADEASSLQILQEETKVCQNILPSFVEAFERNQECSLEQVLISRDLLVQQNLWNNCKNKLKP 1699
gi 655605478 1991 HYSVGHMALLVELSQILQRADEATSLQLLQEESMVCQNMLPLFVQAFEKKQECSLEQILITREVLVEQNLWDNCKHKLKP 2070
gi 15021846   431 HCSANHTAFIANLSQILQRADEASSLQILQEETKVCLNILPLFVEAFERKQECSVEQILISSELLVDQNLWNNCKHTSKP 510
gi 395847409 1595 HRSAKHTALITKVSEILQRADEASSLQALQEETKVCQKCFPSFVEAFERKQKCSFEQIVISRESLVEKNMWNNCKHKLKP 1674
gi 803200311 2012 HCSSNNLAPTVKLTQILRRADETSSVQILQEESEVCQNILPLFVEAFERKQKCSFKQILISRDLLVEENLWSNCRHRLKP 2091
gi 281347426 1628 HYSANHSALIARLAPILRRADETSSLQILQEETKACQNILPLFVEAFERKQECSHEQILISRELLVEQNLWSNCKHKLKP 1707
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 998490985 1703 CAVDTWVELQMAMETIQFIENKKRFLEGKPTFRSLLWYDESLYSELLRRPRGYQLQSNFYPGFQGRLKYNAFCELQNYHN 1782
gi 612029004 2122 QAVDSLVELQMMMETIQFIENKKGLLGSKPTFRSLLWYDASLYGELLRGNQGYQQQACLYPAFQDRLRYNAFSELQHYHD 2201
gi 821490143 2947 RAVDSLVELQMMIETMQFIENKKGLLGSEPTFRSFLWYDASLYEELLRGNKVYQQQFCLYPAFQDRLKYNAFSELQHYRG 3026
gi 351715430 1660 CAIDTLVELQMVMETIQFIENKKRLLEGEPTFRSLLWYDETLYSELLGRPHGYQLQSSFYPAFQGRLKYNAFCELQNYHN 1739
gi 731490157 1700 CALDSLVELQMMMETIQFIENKKRLLGDEPTFRSLLWYDETLYGELLGGPRGYQQQSNFYPAFQARLKYNAYCELQKYHD 1779
gi 655605478 2071 CAVDTLVELQMIMETIQFIENKRRLLEGEVTFRSLLWYDDTLYGELLGRPRGYQQQSSFYPGFQGRLKYNAFCEMQNYHN 2150
gi 15021846   511 SAVDTLVELQMMMETIQFIENKKRRLEGEPTFRSLLWYDETLYAELLGKPRGFQQQSNFYPGFQGRLKYNAFCELQTYHD 590
gi 395847409 1675 SAVDTFVELQMMMETIQFIENKKRLLGGEPTFRSLLWYDETLYGELLVGPHGYQQQSNFYPAFQGRLKYNAFYELQTYHG 1754
gi 803200311 2092 CAVDSLVELQMMMETIQFIENKKRLLGGEPTFRSLLWYDETLYSELLGRPRGFQQQSNFYPAFQGRLKYDAFSELQSYHG 2171
gi 281347426 1708 CAIDSLVELQMMMETIQFIENKKRLLGGEPTFRSLLWYDETLYGELLGRPHGFQQQSNFYPAFQGRLKYNAFCELQNYHD 1787

                  ....*.
gi 998490985 1783 QLVE-F 1787
gi 612029004 2202 QLIKlL 2207
gi 821490143 3027 QLIKlL 3032
gi 351715430 1740 QLIElF 1745
gi 731490157 1780 QLIEvL 1785
gi 655605478 2151 QLIElC 2156
gi 15021846   591 QLVElL 596
gi 395847409 1755 QLIElF 1760
gi 803200311 2172 QLIElF 2177
gi 281347426 1788 QLIElF 1793
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap