Conserved Protein Domain Family
TP53IP5

?
pfam15331: TP53IP5 
Cellular tumor antigen p53-inducible 5
TP53IP5 suppresses cell growth, and its intracellular location and expression change in a cell-cycle-dependent manner.
Statistics
?
PSSM-Id: 317703
View PSSM: pfam15331
Aligned: 17 rows
Threshold Bit Score: 183.041
Threshold Setting Gi: 821459663
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81905727   28 QHVSKVIERNRLKMVLKNLSLLKLFKSSNSRIQELHKLARRCWNSMLRVPKILQISSR-----------------DKD-- 88
gi 655883216  28 QPINKIIKRNRLKMVLRNLSLLKILKSSNHRILELHNLAKRCWNSLLSVPKILHIASR-----------------DNKvs 90
gi 884908602  12 QPVYKTNQQNRLKMVLRKLSLLKLLNNSNSRIQELHNLARRCWNSVLRFPEILGISSGplglssplltvfpfptrGENvc 91
gi 914907749  27 QPVCKTIERNRLKMVLRNLSLLKLLKSSNRRIQELHSLARRCWNSVLRVPKMLRISSG-----------------DSvc- 88
gi 591301832  28 QPVSKAIRRNRLKMVLKNLSLLKLLKSSNPRIQELHNLAKRCWNSLLRVPKILGISTR-----------------SSNvc 90
gi 296480843  34 QPVSKVIARNRLKMVLKHLSLLKLLKSSNPRIQELYNLARRCWNSLLRVPKILGISSG-----------------HDNvw 96
gi 831222135  28 DTLCKGIERNRLKMVLRNLSLLKILKSSNPRIQVLHNLAKRCWNSLLRVPKILRITSG-----------------EDNvc 90
gi 512993168  28 QPLYKAIERNRLKMVLRNLSLLKLFRSSNSRIQELHNLARRCWNSMLRFPKIVHVSSG-----------------ENNvw 90
gi 564302831  55 QPVGKVIERNRLKTVLKNLSLLKLFKSSNSRIQELHRLARRCWYSVLRVPQILQISAR-----------------DNDvc 117
gi 537151337  29 QPVSKLIERNRLKTVLKNLSLLKLLRSSNNRIQELHSLAKRCWKSMLRVPKMLQISSG-----------------DNNvc 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81905727   89 -KVKQNNIKFQ-EIRVLEMRPNSKKAESVKEPKQKTSKKWkpK--QGS------KGSPAAVTWRKKQETFKISKVIKSGG 158
gi 655883216  91 nTEKQNTEELQ-AATCLDKNLESKQFESSAESQETKPPEWesE--VAPetksteEGSPAAVTWKEGQAEPEAPRTSRGHG 167
gi 884908602  92 nQGRRNNEELQ-EATGLGKNLESKKRKSTKEPKEAKCSEC--E--EEPrvsnmvGVSPVAAPRREEQIEPDMPRTSRGRG 166
gi 914907749  89 nEVKKNNEKLQ-EARFLEKTLENKKEESTEESKETRAEDW--KpeIASekrnkeKEPTVTVPL--DQVEPEVPRTSRSQG 163
gi 591301832  91 dRVEQDNEELQ-EAECPEKTLESKKLQSTGELKQ------------GLgernkaQESPAAVLQGKEQMEPELPRTSKDHG 157
gi 296480843  97 dEVEQNNKELQeEAGCSYQKLDSEKLKPTGEPEECEEsrp------------raQ---EAMPQKEEQMEPEAPTTSRGHG 161
gi 831222135  91 nKVKQNNDEFQ-ETRCPKTEPKSKKLEPAGESKETKP-----K--ERSrmrnkaKGSPEAVPW-QEQVEPEAPRTSRSHG 161
gi 512993168  91 nKVKQNNEELQ-EAPCLEKNLESKKVESTGEPKE------------EPgirnmvKGSPATVARKEEQMEAAIPRTSRGHG 157
gi 564302831 118 kKVKEKNAELQ-EVRALEKKPDYKKAESIKEPKQKTSKQWklk--------rgsKGTPAAVTRRKTQKKSKVSKTSKSRG 188
gi 537151337  92 nKVKQNNGEFQ-EIRALEKKPESKKAESIGKSKTKTSNGWksT--EGS------KGSPAAVPWRKEKAKSKVPKTRASLG 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81905727  159 LQ--ARAQKRKTYVKKPRVVFLKTYHhSTTMGKMKALDITDQLVWFEGLPTRIHIPGRRIMCRSSTYRCLKRSCTRFCCA 236
gi 655883216 168 PN--PGAWGTQLPAGGPQANLIKTYH-GTPWEETRQLGAADQGDWFEGLPTRIRLPGPRVMCRASTLRWVKRCCTRFCSA 244
gi 884908602 167 LN--PTARKKQPPTRCPNVVFLKTPSnKTPMGDMKQLDENGQYAWFEGLPTRIHLPGPRVMCRASKLRWVKRPCTRFCSA 244
gi 914907749 164 LN--TGTRGKQPSTGSRRVIFLKTHYhRSPMGDMKQLDTGGQNIWFEGLPRRIHLPGPRVMCRPSSLRWVKRCCTRFCSA 241
gi 591301832 158 LTafPGAQGRQSPKGEPRIIFLKTYQhKTPMGDKQQLEAADQWIWFEGLPTRIHLPGPRVMCRSSTLRWVKRCCTRFCSA 237
gi 296480843 162 LTtsPRAQAQEPPTGDPRVVFWKTHQdRTPMKDVKQPERANQRVWFEGLPTRVHLPGPRVMCRSSALRWVKRCCTRFCSA 241
gi 831222135 162 QN--TGARKRQLLTEGPQIVVLNTNHhRTPMGDMKQRDIADQRVWFEGLPTRVHLPAPRVMCRSSTLRWAKRCCTRFCSA 239
gi 512993168 158 LN--TGAQRSQLATRDPRVALLKTYNyRTPMEDMKQLDVNGQYTWFEGLPTRIHLPGRRVMCRFSKLRWIRRRCTRFCSA 235
gi 564302831 189 SR--TRAQKRKAYVKKPRVVFLKTYHhSLPMGDMKPLDITDQLVWFEGLPTRIHIPGRRIMCRSSALRCFKRSCTRFCSA 266
gi 537151337 163 LH--TRGQKRKPQVKKPQAVFLKTYHhRTPMRDTKPLDVTDQFVWFEGLPTRIRPPGRRIMCRASTFRCTKRPCTRFCSV 240

                 ..
gi 81905727  237 SL 238
gi 655883216 245 SL 246
gi 884908602 245 SL 246
gi 914907749 242 SL 243
gi 591301832 238 SL 239
gi 296480843 242 SL 243
gi 831222135 240 SL 241
gi 512993168 236 SL 237
gi 564302831 267 SL 268
gi 537151337 241 SL 242
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap