Conserved Protein Domain Family
AIB

?
pfam15334: AIB 
Aurora kinase A and ninein interacting protein
AIB is a family of eukaryotic proteins necessary for the adequate functioning of Aurora-A, a protein involved in chromosome alignment, centrosome maturation, mitotic spindle assembly and aspects of tumorigenesis. AIB is likely to act as a regulator of Aurora-A activity.
Statistics
?
PSSM-Id: 317706
View PSSM: pfam15334
Aligned: 15 rows
Threshold Bit Score: 411.163
Threshold Setting Gi: 612024326
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 408387570   28 QTQLIKSSTKMLTLLPGERKAKISFTQRScpsaGTRQTSIASFLTSQQGKTNGADQRSVSSHTESQTNK--ESKEDaTQL 105
gi 408387572   26 QTHLLKLGTKMLTLLPGERKPSIPFTQRR----ATRQTSITSFVTSQPGMANGGNQKNASSLKENQINR--ECKSR-SQL 98
gi 1040178860  26 QTHLIKPSTKILTLLPEERKTNIYLTQRRtphaCVKQTSIASFFTLQPGKTNGGDQRSVPSPAERQINK--EPKNDaSPL 103
gi 731497327   26 QTYLIKSGIKMLTLFPGERKAKISFTQRStppaGIRQTSIASFFTLRPGKTSDGNQTSISSHRESQTDK--ESKKDaTQL 103
gi 348571162   26 QTHLIEPSTKMLTLLPRERTPTVSLTQ-RissaG-KQTSIASFFTLWPGMKDVGNQRSISSHTQSQINK--ESEKDtTQL 101
gi 512977237   26 QTHLIKPGTKMLTLLPRERKP-VSFTQRRipsaGIKQTSIAS-FTLKTGMTDVGNQSSVSSHTESQINK--ESKTDtTQL 101
gi 431891241    2 QTRLMMSGTKILTPFPGERKAKFSCTQRRnlpaSVRQTSITSFFTLQPGKTNGADQRSISSHIESQTNR--ESKKDaTQL 79
gi 558184590  104 QTHLIKSSTKMLPLLPRERKAA-----QRtppaGVRQTSIASFFTLQSGKKN-GDQRSVSSYIESQTNR--ESKKDaTQL 175
gi 532063617   27 QTHLIKPGTRMLTLFPGERKPSISFTQRKspsvEVRQTSIASFFTSQPGMTDGGNQRSVSSHIESHINKesESKTDtTQP 106
gi 664739953   26 QTHLIKPSTKMPTLFPGERKVKISFTQRRtppaGVRQTSIASFFTLQPGKTN-SDQRSVSSHVQSQTNK--ESKKDtTQQ 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 408387570  106 -EHLTQGLRADFMAPPLATSTPADIQEARLSPQSLK-ASCQHGIGTPYLTVPCLFRPDT-SVCAGASKASLACSFAHDLE 182
gi 408387572   99 -DCLDQGLEDDCLVSPLATSTPADIREAGHSPQSSQ-ISGCQSLETTSLTMMSFPQPVV-LMGTGESKAPLASSFTQFLE 175
gi 1040178860 104 rGHLIQGSGDGCMTLPFATSTPADIPETGLSPQLLQ-TSGHHKMGNLLLTELSLLQPDT-LVCAGQSEASLAFSFSQDVG 181
gi 731497327  104 -EHFLHGLHDDCMAAPLATSTPADIQDTGFCPQSHQeTSGSPRLETPVLTALSL--PDT-PVCAGERKASLAFSFTQDWE 179
gi 348571162  102 -DSLIQNSENDCIASSLATSTPEDIQETGFSDKSHK-TSGHHSVRTPFLTMPSLPQPNT-LACAEDNKAPLAFSFTQNLE 178
gi 512977237  102 -DCLIRDSEDDCIAPPLAMSTPEDIQETGLSPWSHK-TSGHYNVRSPFLT---MPQPNS-LVCAGDSKASLAFS------ 169
gi 431891241   80 -DHLIQVLEDDCVAPPLATSTPADIQEAGLSPQSLQ-ASGHHRMGTPFLTVLSLSQSDT-LVCAEESQDSLACSFTQDLE 156
gi 558184590  176 -DHLTQGLGDDCVAPPLASSTPTDIQEAGLSPQSLQ-ASGHHRLGTPFLTVLSLFQPETnLVCAGENQDSLACSFTQDVE 253
gi 532063617  107 -DHLIQDLRDNDITPPLATSTPADIQETALSPLSLQ-TSGHHSLGTPFLTLLPLPQPAT-LVSAGENDASLAFSFTQDLE 183
gi 664739953  103 -GHPTQGLVDDCMAPPLATSTPADIQEAGLCPQSLQ-PSAHHRTGTPFLTVLSLFQPDT-SVCAGESKDSLACSFTQDLE 179
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 408387570  183 SSCLLDQKEge---dSSCEREWLQGSKknNYQSVERHSKTTGHKGHQLLDKTNLE-NVSAKRSRQAPVL-QTYK-DSRRG 256
gi 408387572  176 RSCLLDQRE------AKRKREGLCGSKt-DCPGMGSHIRPPGGKCHQPLDKAKVEkRATAKENRQAPVHlQTYRfGSHSG 248
gi 1040178860 182 RSCLLDQKEgq---kDSSMREWLHGSKk-KSQGLERHSSPARGKCPQSLDKAKLErKVSAKENRQVP---QTHR-ESWNG 253
gi 731497327  180 SSCLPDQKEdkgeedSSGNREGLQRSKknKYQDIERDVKLHGGKCHQPLDRTKLEsKVSAKENRRAP-HtQPYR-DSRSG 257
gi 348571162  179 SSCLQDQKEd-----SSRKKEWFNGSE--NYQDMARHVKPPVGKCHQILDKAKSErKVSAKENRRPSVYlQTSR-DFCSR 250
gi 512977237  170 --CLLDQKd------SSRKKEWFYGSEk-NYQGMERHIRPPGGKCHQLLDKAKSErKVSVKENRQRSVHlQTFR-ESWSR 239
gi 431891241  157 SSCLLDQREre---dSSWKREWLHGSKkkNCQGMERRSKPLG-KGHQPSAKTKLE-KLLAKENRQASAPfQTHR-DSWSG 230
gi 558184590  254 SSCLLDQKEge--kdSSWKREWLHGSKkkNRQGMERRSKPPGGKGLQPWDKPKLE-KVSAKENRQAPVLfQTYR-ESWSG 329
gi 532063617  184 SSCLLDPKEgk--kdSLRKTKWLLGSK--NYQDLERDIKVPGSKCHQLLDKTKLEkKMSAKENRQAPVClQTSR-ESWSR 258
gi 664739953  180 SSCLLGQKEgv--kdSSWKKEWLHGPKkkNCQAVERHSKPPGGKGHQPLHKTKFE-KVSAKEHS---------R-DFWSE 246
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 408387570  257 ANMKAVKQSSCPIPGFSWDSERNDKDSWSQLFTEDSQGQRVIAHNSRAPFRDVTNDQNQGYGRVPNSLWAQCQDRTTQFN 336
gi 408387572  249 KKTLLVTKSPCPLSVFSWDIDRKDRDSWSQLFTEDSQGHQVIAHSTKMPFQDVTNARNQGSGQFPDSPQAQGQDGPTLLH 328
gi 1040178860 254 KNT-AVKRSPCPVSVFSWDSEKNDKDSWSQLFTEDSQGQQVIAHSSRAPFRNISNSCPRGLEQFADSTQALSQVGPTQFH 332
gi 731497327  258 ENTVSAKQSPCPVSLFSWDSERRDKDSWSQLFSADSQGQRVIAHNPRAPFRDVTNDQNQGLQQAPNSPQAWCQDGPAQLN 337
gi 348571162  251 ENTEAVKQNPCLVSVFSWHSEKNDKESWSQLFTEDSQGQRVIAHNIRAPFQDVSNTWHLGLGCFSARPRAECQAEHSELN 330
gi 512977237  240 ENTESVKQNRCPVSVFSWDSEKNDKESWSQLFTEDSQGQRVIAHR-RAPFQDVSNTWHQGLGHFPTSPRAESQAGHTQLN 318
gi 431891241  231 ENTEAVKQSSCAVPVFSLDSEKNDRDSWSQLFTEDSQGQQVIAHNPRAPFQDVTNNWNRGLGQFPDSPWAQYQDRPIQLN 310
gi 558184590  330 ENTEAVKQRSCPVPVVSWDSEKDDRDSWSQLFTEDSQGQRVIAHNSRVPFREVTNSWNQGLGQFPSSPGAQCQDRLTQLN 409
gi 532063617  259 EKTESVKQSPCLLSGFSWESEKIDKDSLSQLFTEDSQGQRVIAHDTRVPFQDLTSAWNRGPGQFPTSSPAQCQDGTIQFN 338
gi 664739953  247 ENTESVKQSPCPVPVFSWDSENNDKDSCSQLFTEDSQGQRVIAHNSRAPFRDVTNNRNQSLGWFPNSTWAQCQDGPTQLN 326
                         330
                  ....*....|....
gi 408387570  337 LQPDSLFTQDSEGN 350
gi 408387572  329 LQPHLLFTQDSEGN 342
gi 1040178860 333 LPPDLLFTQDSEGN 346
gi 731497327  338 LQANWLFTQDSEvh 351
gi 348571162  331 QQPDLLLTQDSEGN 344
gi 512977237  319 LQPDLLLTQDSEGN 332
gi 431891241  311 LQPDLFFTQDSEAp 324
gi 558184590  410 -QPDLLFTQDSEGN 422
gi 532063617  339 LEPDLLFTQDSEAq 352
gi 664739953  327 LQPDVLFTQDSEGN 340
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap