Conserved Protein Domain Family
TPIP1

?
pfam15338: TPIP1 
p53-regulated apoptosis-inducing protein 1
TPIP1 is a family of eukaryotic proteins whose expression is induced by wild-type p53. Ectopically expressed TPIP1, which is localized within mitochondria, leads to apoptotic cell death through dissipation of mitochondrial A(psi)m. Phosphorylation of p53 Ser-46 regulates the transcriptional activation of TPIP1, thereby mediating p53-dependent apoptosis.
Statistics
?
PSSM-Id: 317710
View PSSM: pfam15338
Aligned: 3 rows
Threshold Bit Score: 208.113
Threshold Setting Gi: 675755508
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74718882    2 GSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSDPLVLGAQVHGGCRGIEALSVSSGSWSSATVW 81
gi 675755508   2 GSSSEASFRSAQASCSGARRQGPGRGDQSLSVMPPNGRAQTHTPGWVSDLLVLGAQVHGGCRGIEALSVSSGSWSSATVW 81
gi 304434534   2 GSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSDPLVLGAQVHGGCRGIEALSVSSGSWSSATVW 81
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 74718882   82 ILTGLGLGLSRPFLPGATVLRDRPLGSAFELSYDQKKAPLRLQ 124
gi 675755508  82 ILTGLGLGLSRPFLPGATVLRDRPLGSAFELSYDQKKAPLRLQ 124
gi 304434534  82 ILTGLGLGLSRPFLPGATVLRDRPLGSAFELSYDQKKAPLRLQ 124
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap