Conserved Protein Domain Family
DEPP

?
pfam15343: DEPP 
Decidual protein induced by progesterone family
DEPP is a family of proteins expressed in various tissues, including pancreas, placenta, ovary, testis and kidney. High levels are found during the first trimester. Its expression is induced by progesterone, testosterone and, to a much lower extent, oestrogen. The family is alternatively known as fasting-induced gene protein, FIG.
Statistics
?
PSSM-Id: 317714
View PSSM: pfam15343
Aligned: 13 rows
Threshold Bit Score: 259.761
Threshold Setting Gi: 558164503
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 68565452   25 GGPGQEPPPSPSLDDYVRSISRLAQPTSVLDKATaQGQPRPPHRP-------------AQACRKGRPAVSLRDITARFSG 91
gi 122134561  25 GGAGEEPPASPSLDDYVRSICQLAQPTSVLDEAAaRVRTSRPHRI-------------ARSCAKSCPTGSLQDITTRFTG 91
gi 68565347   25 GAPGQEPPASPSLDDYVRCICQLAQPTSVLDKATaWSPPNRSCRP-------------AWPREKRHQSESLEDSSPCFSS 91
gi 532097632  25 GGTGQDPPASPSLDDYVRSICQLAQPTSLLDKVTaRSRPSRPHRS-------------PRSSEKSHPAASLQDNTASFGG 91
gi 291412613  26 GGLGQEPPASPSLDDYVRSICQLAQPTCVLDKATvQDGLSGPHRP-------------AWGLEETCPTATLQDSTARFGA 92
gi 821450985  31 DELQSDLLSSQSLDDYVKSICQLAQPTSVLDGDQ-RLPYNRLRKPcrlrgktfndstsASHSEKSSPASPMQDITAHFSG 109
gi 354502172  26 apgQEEPPNSPSLDDYVRSICQLAQPTSVLDKI--RSRPHRPYRP-------------AWTREKRCQAESVADSSPCFSS 90
gi 731467820  23 lsrGPEPPPSPSLDDYVRSICQLAQPASVLDEAPaGDRPSRLHRP-------------ARACERSHPAMSLQDIPTCFSG 89
gi 335301941  25 vGPGEEPPASPSLDDYVRSICQLAQPTSVLDEAAaWARPRRPHRP-------------GRSCEKSRSDGSLQDITTHFSG 91
gi 57107161   25 GGPGQEPPASPSLDDYVKSICQLAQPTSVLDMATaRAQPSRTLRP-------------AQAFKKNCPTESLQDITTHFSG 91
gi 410975635  25 GGPGQEPLASPSLDDYVKSICQLAQPTSVLDAATaRAQLGRPPQP-------------AQAFETSCPTESLRDITTRFSG 91
gi 511850908  25 GGPGQEPPASPSLDDYVKSICQLAQPTSVLDVATvRAQPGRTPRP-------------ARAFRKSPPTESLQDITTRFSG 91
gi 558164503  25 GGPRQDPLASPSLDDYRRSICQLAQPTSALTEAAaRAQPSRRPWQ-------------ARAGEKSGSPGSLQDFTTPFSS 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 68565452   92 QQPTLPMADTVDPLDWLFGESQEKQPSQRDLPRRTGPSAGLWGPHRQMDSSKPMGAPRGRLCEARMPGHSLARPPQDGQQ 171
gi 122134561  92 QQPSLPRTGTVDPLDWLFGESQEKQPSKRDVPRRTGPSADPWASRRQTDSGKAPGTPRGRLSDAKAPGHSLQRTSRDWHQ 171
gi 68565347   92 LQPTLPAPGTDNPLDWLFGKSQEQQTDRRDLPNRTG-SSGHWGVHRQMGKD------SGRPSEARVPEYSLGRKPGHRHQ 164
gi 532097632  92 QQSTLPSAGTTDPLDWIFGESQRNETNRRDLLRRTGPSAGHWRAHREANSGKPSGSPRRRLFEARAFGHSLTRPSQDVHQ 171
gi 291412613  93 QQPPRPTAGPADPLDWLFGESQEKQSSRRQPARRTGASAGLGGLHRQTDSGKTRAVPRGKLCEARAPGHSLARTSRDGPQ 172
gi 821450985 110 QHSTLPLGNNIDPLDWLFGESQPKRQSWKDTLRRTGLSTDPSCLHKQNEPGKSRVPRRIRACEAKLPGGPLTKLSSEWGK 189
gi 354502172  91 LQPPLPSPGTDNPLDWLFGKSQEQQADRRDLPNGPD-SSDHWGVHRQMEEN------RGRLCEARLPENSPGRKSGHRQQ 163
gi 731467820  90 QGPLLPRVGTADPLDWLFGESQEKQPTRKDLLRRTGLSANPWGLHRQTDTGKARSGPKARFCDARAPGHSLARLPQGRHL 169
gi 335301941  92 QQPVLPRAGPADPLDWLFGESQEKRPSRRDLPRRTGLPADPQALRKETNSGKAQGGPKGRLCEARAPEHSLERPLRNWHQ 171
gi 57107161   92 QQPAPTRDCTADPLDWLFGDSQEKQPSRRDPPRTTGSSADPWGPHRQMDGGKAQGTSRGRFCDASVQEHSLVRPSRDWHQ 171
gi 410975635  92 QQPAPPRDGAADPLDWLYGESQEKQPSRRDPPRRTGSSADPWGPQRQMDGGKTRGTPGGRLCGARVQGHSLARPSRDWHQ 171
gi 511850908  92 QQPALPGDGTADPLDWLFGESQEKRSSRRDQPRRTGSSADSWGPHKQMDCGKARGTPRGRPWDARVQGHPLARPSRDWHQ 171
gi 558164503  92 QQPP----NTADPLNWLFGQSQEKQPRRRDLPRRTGPSADPWGPHREMESTKAGGCPRGKLYDARAPGHCPVGQLRDWHQ 167
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|..
gi 68565452  172 SSdlrsWTFGQSAQAMASRHRPRPSs-VLRTLYSHLPVIHEL 212
gi 122134561 172 CS----QASGQPGQDAGSPTSPRHSs-ILRTLSLHLPVIHEL 208
gi 68565347  165 TSnlksWTSRKPCQALASVSSSRPSs-ILGTLYLHLPVIHEL 205
gi 532097632 172 SSnlnnWASGQPGRATASPCNPRPSs-ILRSLYLHLPVIHEL 212
gi 291412613 173 SAnlrsHMAGRPSRATDSSYSPRPSs-ILRTFYLHLPVIHEL 213
gi 821450985 190 VWekrtQPSMLNASLKYSSSSHQDR--ISRVLNSNLPVIYEL 229
gi 354502172 164 TSdrksWTSRKSHQALAAVSGSRPSs-ILSTLCLHLPVIHEL 204
gi 731467820 170 SSs---WDSRQ----------PRSSgsVLRALHSDLPVIHEL 198
gi 335301941 172 CS----PASVQPGRDAASSTSPRRSs-ILRTLYLHLPVIHEL 208
gi 57107161  172 CS----WASRQFSGAAASPPAPRPSs-TLRTLYVHLPVIHEL 208
gi 410975635 172 GS----WPSKPLCGTAASPPPPRHGs-TLRTLYLHLPVIHEL 208
gi 511850908 172 GS----WASRQLCTDVASPPAPRPRs-TLRTLYLHLPVIHEL 208
gi 558164503 168 GS----RASRQPIRAAAPPPSSRPSs-VLRTLYLHLPVIHEL 204
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap