Conserved Protein Domain Family
ETAA1

?
pfam15350: ETAA1 
Ewing's tumor-associated antigen 1 homolog
This family of proteins is found in eukaryotes, where members are expressed at high levels in the brain, liver kidney and Ewing tumor cell lines. Proteins in this family are typically between 648 and 898 amino acids in length.
Statistics
?
PSSM-Id: 317720
View PSSM: pfam15350
Aligned: 18 rows
Threshold Bit Score: 705.392
Threshold Setting Gi: 118403814
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122132267  77 YETPKRMLQMDLLSSTFSSP-NDPDGQNDIFWDQNSPMTKQLDKGRKKQLYTTDSDEISHIVNRIAPQDE-KPT--TDSM 152
gi 81862532   79 KETPVQIVKMDLLSCTFSSP-NDPDGQTDIFWDQNSPMTKQLGKGRKKQISSAYSDEISHIVNRIAPQDE-KPV--TNSM 154
gi 611982385  75 YKTPKRLLKTGFRSPIFTSPyNDIDGQQEIFWDPNSPTTCQLDERRNKQHDRRCSVAISDIVNRIAPQGE-KPT--TDSL 151
gi 620979384   6 YKTPKRSLKTRLRSSTFSSPyNDTDAQQEIFWDPTSPTTYKLDKRRKKQADRKSTVEISEIVNRIAPQDE-RPV--RDTL 82
gi 524990219  90 HKTPKRSLSRKSRIPTFSSPiNDTETQQEIFWDSHSPVAHKLGSGKTKQSTSTCAVEISEIVNRIAPQDE-KAAcnEDSL 168
gi 514769744  30 hKTPKRSLSRKSRIPTFSSPvNDTDIQQEIFWDPHSPIARGLGNEKNKRSTRRCAVEISEIVNRIAPQDE-KAAcnEGSL 108
gi 348566389  67 YETPTRMLKMDLLSCTFSSP-NDLDGQNDIFWDQNSPVTKQLGKGRKKQIYTTDTDVISHIVNRIAPQDD-KPA--ANPM 142
gi 625198271  14 YETPTRVLKTDLLSCAFSSP-NDPDGQTDIFWDQNSPITKQLGKGRKKQISSTYTDEISHIVNRIAPQDE-KPV--TNSM 89
gi 914903587  77 HETPQRVLKMDLFSCTFSSP-NDPDGQNDIFWDQNSPMTKQLGKGRKKKIYTTGSDEISDIVNRIAPQDEkKPT--TNSM 153
gi 611982387  36 YKTPKRLLKTGFRSPIFTSPyNDIDGQQEIFWDPNSPTTCQLDERRNKQHDRRCSVAISDIVNRIAPQGE-KPT--TDSL 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122132267 153 LGVWIGDTAIPCTPSVAKGKSRTKLSCTK-LKSQNQEEELMKLAKQFDKNMEELDVIQEQDKRNHDLIQMISEAETSLNC 231
gi 81862532  155 LGVWIGETAIPCTPGVAKEKSRVKASCTK-LKTKNREKELMKLAQQFDKNMEELDVIQEQDGKNHDFIQMTSKMGHLDNH 233
gi 611982385 152 LDMWIGEGAIPCTPDITKIKSRTKTNYIR-FKAQSSEEELIKLAKQFDKNMVELDVRQEQENETCGFVQTISEAETSNTC 230
gi 620979384  83 LDIWIGEDAIPSTPSVAKVRSRTKASCTR-LKAQNGEEELMKLAKQFDKNMVAQEAIQEEDHESHDVIQTSLETETLNNY 161
gi 524990219 169 LGTWIGEDAIPCTPVIVKGRARTKLSCTRdLKIKNPEEELMKLAKEFDKNLVELDAVQEQKKLGHNFIQTTSEP--SSNS 246
gi 514769744 109 LGTWIGEDAIPCTPGAVKVRARTKlscTRdLKIKNPEEELMKLAKEFDKNLVELDAVQEQEKLGRGFIQTASDS--LKSY 186
gi 348566389 143 LDIWIGETAIPCTPVVAKEKSRVKISCTK-LKTQNREKELMKLAKQFDKNMEELDVIQEQTKKDHDFVQIISDTETLHNC 221
gi 625198271  90 LGVWIGDTAIPCTPSVAKEKSRVKISCTK-LKTQNREKELMKLAKQFDKNMEELDVIQEQDGRNNDFIQTTSEVGHLHIH 168
gi 914903587 154 LGMWIGAAAIPCTPNVAKEKSRVKVSRTK-LKTQYREKELMKLAEQFDKNMEELDVAQEQNKRNHDFIQEISKAETSRSC 232
gi 611982387 113 LDMWIGEGAIPCTPDITKIKSRTKTNYIR-FKAQSSEEELIKLAKQFDKNMVELDVRQEQENETCGFVQTISEAETSNTC 191
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122132267 232 RDNVQMq---LLCDTVPEIDKALLkkpVKENTKISV-VND-QTSSQKPFDQNAEAAFIAMFDGSTQKCSGQLSQDL-SDS 305
gi 81862532  234 KDSVQK----PSGDVVPEITCTPVkkqMKGDSRISL-AKA-QDSSQKPFDQNVEAAFNAIFDGSTQMCSGQLSQDL-LDA 306
gi 611982385 231 KEAAQIqdlqSASDKVPETDIAVR---VKENSNISReEND-KNNSQTNFDPNAEAALTALFDGSTQKCSGQLSQGL-SHV 305
gi 620979384 162 TDDAQTqdlqSFPDEVPETSIALSlkaRKQSADNAA-AERcPNTIQKAYDPNAEAALTALFDGSTQKCSGLLSQDL-PDV 239
gi 524990219 247 KDEINMknqkSLLAEDSETDISVSmkpVGQSTGIPV-AEPcQSSSQKSVDLEAEVALHALFDSSTQKCSGHLSQGL-SDI 324
gi 514769744 187 KDEVNRknlkSLLSEVSETGAALSlkpVAESTGITA-AEPcLSSSQNSVDLEAEIALHALFDCSTQKCTGQLSQGL-SGI 264
gi 348566389 222 KDCVQMh---SSCEVVPEIDNATLnkpVRGNLVISV-AND-QTSSQKPFDPNVEAAFNAIFDGSTQICSGQLSQDL-SDA 295
gi 625198271 169 KDSVRM----ETDDKVPEISCALVkkqMEGNIGITV-AEE-QDSNQKPFDHNVEAALNAIFDGSTQMCSGQLSQYLsSEA 242
gi 914903587 233 NDYVQMh---PLHDVVPIIDNAIIkkpVKGNTRISV-AND-QSSSQKPFDQNAEAAFNALFDDSTQKCSGQLSQDL-ADA 306
gi 611982387 192 KEAAQIqdlqSASDKVPETDIAVR---VKENSNISR-EENdKNNSQTNFDPNAEAALTALFDGSTQKCSGQLSQGL-SHV 266
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122132267 306 FLKTSNTTFGKKNTLKEEKIITNESVVTEN-------LPSK--TLGS---------------------LSHQVDNPGMTK 355
gi 81862532  307 FLNNSKTSLRKKNALLQEEIITTETLLTEN-------LLNK--TPIS---------------------LSPQIDTTVILN 356
gi 611982385 306 SFTTSHNIHGKNNTLKEEIENSTETVVTEKhvnkishQQNL--TPLS---------------------VTSASDSLLMAK 362
gi 620979384 240 S-SSAGVSQRNNSTLIEEKQMNRGELADVD-------LPQKdsTTTT---------------------VTSKMDT--VAK 288
gi 524990219 325 SLNNS--FHKIKSTLEEEN------------------LPEK--VEDMqkdtmfa--------vgsmdqTVPKPDTDTLTK 374
gi 514769744 265 SLNNS--FHENKRTLEEEH------------------LPEQ--IKNTqhgnsdacqkhnlyalgsvnqTLPKTDTNTLTK 322
gi 348566389 296 FLYNSNTTLGEKSPLTKESIITDKTLVTEK-------LPSK--TPVP---------------------LSPQVCVPTVTK 345
gi 625198271 243 FLNNSKSTFVKKSSLIEEDIIINETLLTEN-------LPNK--TSLS---------------------PSPQVDTPLLQK 292
gi 914903587 307 FLNT------RKNTLKEEKIIINGTLVTEK-------LPGK--TQDS---------------------LYPQVDPPILTK 350
gi 611982387 267 SFTTSHNIHGKNNTLKEEIENSTETVVTEKhvnkishQQNL--TPLS---------------------VTSASDSLLMAK 323
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122132267 356 ------SY-VTFCTKEPGTFNKH-IDTFTTS--DF--EDDWEN-LLSNEPFVMQNIETSELFPApKTIQIADQKEMCSF- 421
gi 81862532  357 ------SC-VTPCPKTPAAPDTQ-LDELTAN--DF--EDDWES-LLGSEPFLMENAEMLEFVPS-TTAQDTCQKAICTS- 421
gi 611982385 363 ------SN-VTSSFAKSEIFDKP-GKVDVSIdfDD--DDDWEH-MLTDDAFVMPISQAPELLTTsETSQLILQKDICRLt 431
gi 620979384 289 ------ETpKISSTPKSSTSNKP-TQDQTNS--DF--DDDWEDcFLQHNSLELQTAENPELTTTpRRSRTAHPEANRTP- 356
gi 524990219 375 nph-lkIQ-LMASAKLAGVVN---------D--DF---DDWDTdLLADDSFVMQITQNPELISTeEPPQIPANPLVHDFs 438
gi 514769744 323 kntplkKQ-VVVSSKPAGVVN---------D--DF---DDWDTdFLADDSFVMQITQNPELINTeeaatipintsvrgfs 387
gi 348566389 346 ------SY-LTPKTKEQEESNKH-VVAFPTN--DF--EDDWES-LLENEPFVVQNTEMLELFPS-KTAH----------- 400
gi 625198271 293 ------SC-VTPCAKKPEASNKHaADGLTGS--DF--EDDWES-LLGNEPFLMENAEMLELFPS-TTAQVTGQKAICTV- 358
gi 914903587 351 ------SC-VTPYSKEPEASSKP-IGTFTTS--DL--EDDWEK-LLSNEPFVMQNVE-AELFPS-KTAQVTDHKGIYSF- 414
gi 611982387 324 ------SN-VTSSFAKSEIFDKP-GKVDVSI--DFddDDDWEH-MLTDDAFVMPISQAPELLTTsETSQLILQKDICRLt 392
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122132267 422 NS-KEAKSKSGMNKSVDVK-LRDSKILQGLPSNTWNNELTDAEKYRFSPKP---NDKPNKLSTTGNKMKLEKSFNIV-V- 494
gi 81862532  422 VG-ENDTITSRTNMNLGGR-LRDSKVTLDLPSKTRNGELRNAGEHRFSSHP---GDESRKVPFTGNKVSFEKSVTSI-V- 494
gi 611982385 432 TS-KNDKAKVGLNGNLAIS-KSLSKNLQDLSSETNNKDFLDPTKSLFPPKP---NNEAMEFVPPENDVTFERNLNKT-S- 504
gi 620979384 357 TSnESKETKARISRTSVVG-VT---NIQDVTSETNSRDVNGIAKSLFSKKP---RDEENVVVPHGSNIKTDERTIHIgS- 428
gi 524990219 439 DA-SRTKQRSSGNSAALLGtVNKSNSLQYSPLKHSSKNSQNVVKSLSLQKScktKNSETHALHGKCDVKPDKIKSIW-Ks 516
gi 514769744 388 DA-SRTKERSSCNSVISLEgVHKSKSSQFSPLKHPSKNTHNVAKSLSLQKP----------FNKMENSKMATTGSTW-Rs 455
gi 348566389 401 -----DNSISGTNTSLDTR-LRDSKILQDLPSNTHN--LRDTREYSFSPNP---NRKTSNLPLTGNEMKFEKSFNKV-V- 467
gi 625198271 359 AA-KNDTITSRTNTDLGGK-LRDSKITLDLPSKTCNKELRNSGSYRFLSRP---SDESSKLPFTFSNVKd---------- 423
gi 914903587 415 TS-EYGGNTSRTNKSLDAK-LGDSEVLQDLPSKTHNRELIDAGKYRFSSNP---NDKSSKLSSTRNKMK---SSSKI-V- 484
gi 611982387 393 TS-KNDKAKVGLNGNLAIS-KSLSKNLQDLSSETNNKDFLDPTKSLFPPKP---NNEAMEFVPPENDVTFERNLNKT-S- 465
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122132267 495 NQDkiQDC---AVASNLTKVNEDTHTKFNCKVNASEKKSALkPGCS-----------NKSIFN-QSLKVPaNVKPFGSAT 559
gi 81862532  495 SKD--EDY---VAVSNLEKVKEDSRNKCILNKHSSNKSSSY-TRYPsk-------qsSELGVN-LPLQVP-TTDPFDSVF 559
gi 611982385 505 FPNkiPDYpelSVASNIQKIKELNCPKFGPDIKVSAKESALvKRHTnhqlqtggdreNWPNCY-QSFNVPaKTNPNNSIR 583
gi 620979384 429 VPDrvSHS---TPSGSKVNAKEESKPEAGQSRNASVRESTSaSGQLqhggd--rkstSTVFRN-SSFNVSaTVSAYGSSR 502
gi 524990219 517 SQNsdLNHipvSVQSEMKNGNESTKPKSDAFPL-------FpSRYNhhrqsgvkpgnNTHTIScQSSSVStNMKPNDLIK 589
gi 514769744 456 AQNndFSYipiSMQSQVKNGNETVEPKGNSVL--------FpSRPNphrprtekpgsNLPNIFcESANIStNTKPSDAIK 527
gi 348566389 468 IQDktQNF---TVVSNLTKIKENIHTNFISNVNASEKK-PLnTKSSse-------qkNKPILK-HVFTAPvNIDSFGAAT 535
gi 625198271 424 -----EDC---VDVSNLTRVKEDSGSKCNFNVLASDSSGSY-SRYPne-------qkYGFSVN-PPLKTPaVTAPSGSVF 486
gi 914903587 485 SQDktQDC---ADTSNLTKVKEDICINYTSNVNNSEKKSALnTEHSie-------qkNKPIFD-QSFKAPvNIDPFGSST 553
gi 611982387 466 FPNkiPDYpelSVASNIQKIKELNCPKFGPDIKVSAKESALvKRHTnhqlqtggdreNWPNCY-QSFNVPaKTNPNNSIR 544
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122132267 560 LGSTT------SVCNPDQTNGSKLGSFFDDWNDPSFTNEIVKACHQLENSW-EA-DDVDDDILYQACDDIERLTQEQnir 631
gi 81862532  560 LGKEN------IVCSTNQSHGSKLNSSFDDWNDPLLASEMVEACHRLEATW-DA-GEVDDDLFCQACDDIERLTQQE--- 628
gi 611982385 584 ISSET------NFHNLILKDAPQQCSAFDDWNDPKLATEVIEACHELEKSWdAD-DDDDDDLLYQACDHVEKLTQQQdlr 656
gi 620979384 503 ANKET------LCPFTQSETQQQAPEGLEG------SGEVTERCHKPES-W-EL-NDVDDDVLYQVCDNVEKLTKQQncq 567
gi 524990219 590 VVNQAn-----SGQPNQVEIPKKCPLSFDDWNEAKFSDDVLGMFCRSDSLW-DA-NYEDDELLYQVCDDIEKQTQSQdve 662
gi 514769744 528 VVNQAntghvnTVE-----IPKKSTPSFDDWNEPKFSDEVLDMFCESDSLW-DA-NCEDDELLYQVCDDIEKQTRSQdak 600
gi 348566389 536 -----------GVSNLNQTNASKLDSFIDDWNDPLFASEIIKACHKLETTW-ET-NDVDDDLLYQVCDDIERLTQQQd-- 600
gi 625198271 487 LDKEN------SVCNTNQTNGLKFSSSIDDWNDPLVASEMIKACSELETTW-EA-DDVDDDLLYQACDDIEKLTQQE--- 555
gi 914903587 554 LDCET------VVNKPDQTNASKLGSFFDDWNDPSLANEIFETCHRLETSW-EA-DNVDDDLLYQACDDIERLTQQQdil 625
gi 611982387 545 ISSET------NFHNLILKDAPQQCSAFDDWNDPKLATEVIEACHELEKSW-DAdDDDDDDLLYQACDHVEKLTQQQdlr 617
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122132267 632 vdSKTSESVLEINNSSKHGAKNVFTTPKQG-SQFMQSKHLNLNSiSAQTSSLANSLQINKsVKMERGEMYGNSPGFLGat 710
gi 81862532  629 --NKGSEESESVSYTSTRGSRSSSTASKQA-SQSAPSKHWNVVS-SAVPLSLANKSQMSKpVTVQKRGRCGDGPNILDa- 703
gi 611982385 657 kdNKGSENKQMVNYNSSLGLETNSITSDKR-YQFQQHKHLNTDNvSAHETTFREVIQTDK-LAVKEGTNYGNSTNTTGi- 733
gi 620979384 568 qeGKESESMDKAGDISKTGSDSGLTSTKPGqPNHQSIDRLNVH---RNVSSLLKSCQSESiSTSGNKVNCGKSVTTKGvs 644
gi 524990219 663 qgNEKTKTIQGASVNFRSNTDNIFLASKQGlPDLLLAQKTNAKQ--QDAPSLNDS--------------CRNSSKIVHgl 726
gi 514769744 601 qgNERAKTVQGASNLSRTNVDSGFTASKQGlSDRFVAQKPNAK---QDGFLLNNS--------------GRNFSRVTHgl 663
gi 348566389 601 --iKDSKSTLEINNNTKHGHKSLPAVSKGG-SHLEQPKHLNLGSfSAQTSFLTSNSQIGKpMKMKKREVCENSPQILGpt 677
gi 625198271 556 --NKRSKQSESINNTSKQGSRNIYTASKQR-SQSVPSKHWNLVS-SSVPPSLTDNSQIHKsVKVEKRDPCGDYPNILYat 631
gi 914903587 626 kdNKTSESILEINDSSKHGSKNISTTSKQG-SQLAQSNHLNLGSiTVQTSSLTVGTQINKsVKMEKREMSGNSSEFWGtt 704
gi 611982387 618 kdNKGSENKQMVNYNSSLGLETNSITSDKR-YQFQQHKHLNTDNvSAHETTFREVIQTDK-LAVKEGTNYGNSTNTTGi- 694
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122132267 711 T------------------------------------NLSIYSKNSDcqisnlhvscNNPDVPKQVNSs----------- 743
gi 81862532  704 T------------------------------------NLSVCSKNSS----------DNKRGPVQVNSs----------- 726
gi 611982385 734 K------------------------------------NLSEEYKYPNyhnsnqhaswNNSNVPAGMNKs----------- 766
gi 620979384 645 TdvgtqfenprgqtqsqrvpgnvpvkvntscavpihrLTPHAHMNQNgisssiniswSERLSPNGTLShcgnsvntpwip 724
gi 524990219 727 A------------------------------------TTGHVvs------------yKNTSNPQTVISgps--------- 749
gi 514769744 664 T------------------------------------TTGQTvn------------cKNVSSPLSMISgts--------- 686
gi 348566389 678 T------------------------------------NLTPCSKNSNceinsvhvswSNSDAPIHMTSs----------- 710
gi 625198271 632 T------------------------------------NLSVCSRNSI----------DNQYIPVQVNGs----------- 654
gi 914903587 705 T------------------------------------NLTTYSKNSNcqmnnlhvyrNNSDVLMQMPSs----------- 737
gi 611982387 695 K------------------------------------NLSEEYKYPNyhnsnqhaswNNSNVPAGMNK------------ 726
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122132267 744 -------KSVLTGSSSLNVG------------------S---------------------------HHMSTEIAAs---- 767
gi 81862532  727 -------KFVLGGSSNLNVN------------------L---------------------------GLMSTKIAT----- 749
gi 611982385 767 --------STFTGNLSLGIR------------------S---------------------------GHIHTDFPPd---- 789
gi 620979384 725 katraqcKNLQYQNFGQQIS------------------DtvpvrvnascsitsgrpiphlqesgndHNVRTGVPGy---- 782
gi 524990219 750 ----vecKYTLPKNCHQDASedtaktvsgkwyrsnsvpA---------------------------GETGSEGSPvnavn 798
gi 514769744 687 ----mdcKYTLSKNYHQAASedttksisgkwyrsnsvpA---------------------------RETHSETSPantin 735
gi 348566389 711 -------RSFLSRSSDVNGS------------------S---------------------------NHIGMETVN----- 733
gi 625198271 655 -------KFILEGSSSLNDS------------------L---------------------------GRMSTEIAT----- 677
gi 914903587 738 -------KSVFAGSSSLNVN------------------S---------------------------NYVSPVIASn---- 761
gi 611982387 727 -------SSTFTGNLSLGIR------------------S---------------------------GHIHTDFPPd---- 750
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122132267 768 ---KNRLSTLHLSKSTTRGKAQSDlNRAV--RL--SEYVFtKMKNCPmlspFNNSSV-T-GSISDTKIA-QGLEKNKTVN 837
gi 81862532  750 ---NMKLSTQQLSHNSLADTAQND-NKIL--KL--PKFTF-KKKNPQ----LNQNHL-V-GSVPVGKIS-EDLGKRETVN 813
gi 611982385 790 ---SRHLHNQKLSPSVITTQTHCHvNNTS--IPtsSGFSFtKIKNPQtl-hFSHNSIsP-GSKSDTKIL-QHSERSKTQI 861
gi 620979384 783 ---DGQLQNQNLSRKRTTPHTTYg-NKTSv-AP--PKYTFtKIENTLvq----------vNSGSAIKMVpQTLKESTDQS 845
gi 524990219 799 vfsRKALDSSHFLCNAGKIPSSSSgNKTSl-VP--SKFKFrKINNSQsslrVGSENP---GNHSGIGITlQGLEESKNQV 872
gi 514769744 736 vfsskrfdgqdllnntGKTTNNNSgNKTSa-VP--SKFKFrKTNSSQnalhVGSENP---GSHSGIGIApQGLEGSKNQV 809
gi 348566389 734 ---SKRLSTQRLSCVTTARETHSD-PKTG--RS--SRYTFtKLKNSQtnpqFHQNHS-A-EHMPATRIT-QSVEKKKTVN 802
gi 625198271 678 ---NTKFSTHQLSHKTLADRTQND-NKIL--RV--SKFTF-KTKNPQvlsqLNQNCI-A-GNMPVSKTL-QDLGKKETVN 745
gi 914903587 762 ---KKKLITQQLFHRPQTDEAQSEfNKAV--RF--SKYTFaKTKNPQilcqLNQNCI-E-TSMSTTKIS-QDLEKKKTVN 831
gi 611982387 751 ---SRHLHNQKLSPSVITTQTHCHvNNTSipTS--SGFSFtKIKNPQtl-hFSHNSI-SpGSKSDTKIL-QHSERSKTQI 822
                        970       980       990      1000      1010      1020
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 122132267 838 --PLPgKAVQQQPL---VKFSEPLKQPSK--EEEEKNRKCSPEEIQRKRQAALIRRMAKA 890
gi 81862532  814 --SLL-EANQQQSS---INYSESLKPSSP--DEEERNRKYSPEEIQRKRQEALVRRKAKA 865
gi 611982385 862 vsSLPgETVPPQFLk--RQFSESHKQSTK--EEEEKNRKYSPEEIQKKRQEALVRRMSKA 917
gi 620979384 846 teSLPgKESVPRHHclkRQLSESSTRASS--GTEEESKKYSEEQIQRKRQEALARRKSKl 903
gi 524990219 873 nvTLHsKLDNKKSPf-kRHLSESFAQTTSvsVVEQKNRKCSQEEIERKKQEALARRKSRT 931
gi 514769744 810 hvALYsKPENTKPPf-kRHLSESFALSTSvaVVEQKNRKCSQEEIERKKQEALARRKSRm 868
gi 348566389 803 ----LqEADRQQPS---VKLSESLRQSSK--EEEEKYRKCSPEEIQRKRQEALVRRKAKv 853
gi 625198271 746 --SLL-EDNHQRSS---IKYSASLTPSSK--DEEERNRKYSPEEIQRKRQEALVRRKAKA 797
gi 914903587 832 --SIPrEANQQMSL---VKISESLKQSSK--EEEEKNRKYSPEEIQRKRQEALVRRMAKA 884
gi 611982387 823 vsSLPgETVPPQFLk--RQFSESHKQSTK--EEEEKNRKYSPEEIQKKRQEALVRRMSKA 878
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap