Conserved Protein Domain Family
JCAD

?
pfam15351: JCAD 
Junctional protein associated with coronary artery disease
JCAD is a component of VE-cadherin-based cell-cell junctions in endothelial cells. The cell-cell or adherens junction is an adhesion complex that plays a crucial role in the organisation and function of epithelial and endothelial cellular sheets. These junctions join the actin cytoskeleton to the plasma membrane to form adhesive contacts between cells or between cells and extracellular matrix. The junctions also mediate both cell adhesion and cell-signalling. JCAD localizes close to the apical membrane in epithelial cells. This family is found in eukaryotes.
Statistics
?
PSSM-Id: 317721
View PSSM: pfam15351
Aligned: 19 rows
Threshold Bit Score: 1748.84
Threshold Setting Gi: 1040190161
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166218835     1 MYSVEDLLISHGYKLSRDPPASREDNPKGRQAARTGTRAGQG-LQNGHEDGPAALAHRKTSAG-KGHVSDSES------R 72
gi 166218820     1 MYSVEDLLISHGYKPARDAAAPCEDKSERCRSTRTGPRAGQG-LLNGYKDGATAHTHSRTSLG-TGHVSNSEN------R 72
gi 914919398     1 MYSVEDLLISHGYKPSRE---PCEDNPEGRQRARTRTRGARG-LMNGYEDGPVAFKHSKSSPG-TGHVSDSES------R 69
gi 444732757     1 MYSVEDLLISHGYKLSRDHPAAREDDREGRQPARTRTRAGHR-LLNGYEDGPAALAHSRPSLG-KGHVSDSES------R 72
gi 637309679     1 MFSVEDLLISHGYKLSKNSTNLYENRSDGFQHEVTDRRVSHG-PLNGFPTNSAAFANSKKKTGtKSALNDNESshvfrgR 79
gi 1040190161    1 MYSVEDLLISHGYAPSRELPAPRPESPEGRPQARTRTRTGHG-LLNGCEDGPAAPARRKTPPG-KGHVNDPDR------R 72
gi 348565947     1 MYSVEDLLISHGYRPSRDLPGPRGTKADGHAQARTRPRGSQG-LQNGCEDGATTLAPSRPALA-TSPVSTPEG------H 72
gi 351713845     1 MYSVEDLLISHGYKPARDLPGQRGAKADGHPQAKTRPRGSQG-LQNGCEDGIAALAPSRQAPG-PGPVSAPEG------H 72
gi 959065362     1 MFSVEDLLISHGYKLSKNPPVSYENRYDGYRHEITGNRSAQRtALNGIEAESRTGAYSKRPLV-KTSSSSTESshgsqgR 79
gi 971381703     1 MFSVEVLLISHGYKLSKNPPASYENRYDGYRHEAAGNRSAQR-TLNGFEADPRA-AYCKKPLT-KTNSSSTESshgsqgR 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166218835    73 RSTPRGHGEPQSTSASRTSEAGFCNQPPSAWSSHPPTGNDQAYRRRGRQEArsqk-preHENLEARGmaQAHSLPVHVRE 151
gi 166218820    73 ISRPRGHREHQST--SRTPEARFLNQPSLAWSSQPQSGRDDIYWSRGRQEGsgslcprdWKELESRGmaQAYSLPVHVRE 150
gi 914919398    70 RGTPRGHGERPSTSASRAAEAGFYNRPTLAWSSQPQIGNNQAYWRRGGQKVssllsprdRQDLEVRGmaQAHSMPIHVRE 149
gi 444732757    73 RSTPRGHGEPHSTSASRASAAGFYNQPALAWPSQPPPCDDRAYWRRGGQGVrsllgpreREDREAGGmaQAHSLSVHTRE 152
gi 637309679    80 QPVSVYHQDVPASTNIYAPEARFYDQSQLNWSSCPKTEKDLAYWRRRGQDFsallgntgKEDSETKGmaVPCALYGHDKK 159
gi 1040190161   73 RREPPS-----------AAEAGFSNRPALVWSAQPPPRDDPGHWRR-GPEGsgllgsreRKELGIRAmaQAHSLPAPMQE 140
gi 348565947    73 RGAPRHHVEPHRTSASGAAEAGFYNQAASVRSSQSQIGTDQACWRR-GQKAtsllgpqdPDDLEVRGvaQACGLPAHMRE 151
gi 351713845    73 QGVPRHHVEHHRTSASRAPEAGFYKQPALAWSSQAQIGNDQVCRRR-GQKAssslgprdRDEPEGRGvaQARSLPVHMRE 151
gi 959065362    80 QAGPGYHHDLQGLSTFHTSEGGVYDRPHLAWSPQPKTDKDLAYWRRRGQDFsvllgysqKSSVEMKGlaATPGAPRHPKE 159
gi 971381703    78 QAGPGYHHDLQGLSTFHTSEGGVYDRPQLAWPSQPKSDKDLAYWRRRGQDFsvllghsqKGGAEMQGlaAAHGAPRHPKD 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166218835   152 GPWEVGGRSEHVMKKPVWEEELRMSGPAKWQNVSLESWNQPRKLGRQMSDGDGERLFQD----LYPFIQGEHVLNSQNKG 227
gi 166218820   151 NLWEVAGRTEHVMKNAIWEEELRM------QDMSLESWKKPRELGRQASDGDGRKRPQEkfegLYPFVHGEH--TSQNRK 222
gi 914919398   150 GSWEVGGRTEDVMKKAVWEEELRMSGSAKWQNVSLESWNQPRKLGKQMSDGDGEKLFQE----LYPFIQGEHVLTSQNKK 225
gi 444732757   153 GPWEVGRRTEDVMKKAIWEEELRTSGAAKWQNVSLDSWNQPRKIGRQMSDGDGEKLFQD----LYPFIEGQRVLNPQNKR 228
gi 637309679   160 GQWEVGGGGEKI-RRTNMQEKWKPSADYRWQTLRTESWDQPTVFGGLVSHGDKERLLQD----KYSGRQVNAAATSHAKG 234
gi 1040190161  141 GPWEVGGRTEKVTRKATWEEELRTS-PGRWPDGSLESWSQPRQLGRQMSDGGGQRLPHN----LYPLGPAEPAWTAQSKR 215
gi 348565947   152 GPWDVGVRTEYVMKKAVWEEEPRMSGPDKWQNVSLESWNQPRKLGRQMSDGDREKLFQD----LYPFTQGEHALTSQNKK 227
gi 351713845   152 GPWDVRGRTEHVMKKAVWEEEPRMSGPAKWQNVSLESWNQPRKLGRQMSDGGGEKLFQD----LYPFIQGEHALTSQNKK 227
gi 959065362   160 NQLKVGTGAGHV-RRSGLQESCEVPRDCKWRSLEVESWNQPKKVGRQMSEGDREKLLQE----LYSLTLGDNVLSTHSRG 234
gi 971381703   158 AQLKVGLSTEYV-RRSGLPESCEGPGECKWQNLRTESWNQPKKVGRQMSDGDREKLLQE----LYSLTLGDDVLGSHNKG 232
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166218835   228 KSRSLPRVLSPESLSCTEIPIPLNERHS---PKMPPYPPTCAPNLDSTRNSEKSGCSAPFPRPKFGRPLKPPSYSSHQQS 304
gi 166218820   223 KSQSLPRALSPKSLNFTEIPVPLHDGHItgvPKVPPYPPSFPSPSEPMRNLEKASSSGPFPRPKFGKPLKTPCYSSHSQP 302
gi 914919398   226 KSRSLPRGLSPESLSCMEIPIPVSDGHVpdiPLISPYAPNCVPHLESTRNPEKGGSLTPFARPKFGRPLKPPLYGSHQQT 305
gi 444732757   229 KSQSLPRVLSPEGLSCTEIPISMGDGHLpgvSKMPPYPPNCAPSLESTRNPDKGGSAGPGPRPKFGRPLKPASFGSHQSR 308
gi 637309679   235 KSQSLPRVLSPESLRCVEMPSLITKKHSfsgTKTVSCPPTGL-SLETSRYPNAVAQFLPLPKPKYGRPLKPPSYELHQQT 313
gi 1040190161  216 KSRSLPRVLSPESLRYMEVPIPFSDGHVpgvPQMLPY-PNCAPSLDCKRNPEKA----PLPRPKFGRPVK---------- 280
gi 348565947   228 KSQSLPRVLSPESLSYKEIPIPLDDGHLpgiPKVPPYAPNCAPHSELVRNPEKAGSSAPFPRPKFGRPIRP-LYGSHPQP 306
gi 351713845   228 KSQSLPRVLSPESLSYVEVPIALNVGHLpgvPKVPPCPPSGAPHLESTKTSEKAGTSAPFPRPKFGRPLKPPSYSSHSQP 307
gi 959065362   235 KSQSLPRVLSPESMRCVEMPSLTNSNNSlsvTKTPSYPPNRL-SVEPAKHHGTGGHVLPLVKPKYGRPLKPPSYELQRQT 313
gi 971381703   233 KSQSLPRVLLQESMRCVEMPSLTNSNNSlsvSKAPSYPSHRL-TVESAKHHETGGHFLPLVKPKYGRPLKPPSYELQRQS 311
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166218835   305 RGGADSSDSQDSQQMDAYV--------PRHELCLSDPGLEPPVYVPPPSYRSPPQNIPNPYLEDTVPINVCGGHSQQQSP 376
gi 166218820   303 RG---EGGFQDHQHRDPRGsyptrskdPSHELGMLDPGLEPPVYVPPPSYRSPPQHIPNPYLEDPVPRHVSSNQSQQQVP 379
gi 914919398   306 RG--ENSDLQGSQQTDPHGsyptktndSRHELSMSDSGLEPPVYVPPPSYRSPPQHIPNPYLEDTAPRHVSSEHSQPQHL 383
gi 444732757   309 --GVESSASQDSLQTDLSVsgsttaqdPRHELCASDSGLEPPVYVPPPSYRSPPQHIPNPYLEDTAPRHAHGSHGQPQHA 386
gi 637309679   314 RGSLETNSLQDDLRKDEAIssltkisdPTQDVCTQDSSLEPPLYVPPPCYKSPAQQSMDQHLPSEVPDYDMCFNNGIQSP 393
gi 1040190161  281 QGGGGHGDPQASQHGAPHVscwskanePRHELCGSDPGLEPPVYVPPPSYRSPPEHIPNPYLEDAAPTPSSSGHGQQPHL 360
gi 348565947   307 RGG-ERSSLQDSQQVDLHSsclnrtsgPTHEPSVPDCGLEPPVYVPPPSYRSPPQHIPNPYLEDSVPSYVSGEHGSQHQP 385
gi 351713845   308 RGG-ERGSPQDGscfp-------rtsdPGHEPSAPDCGLEPPVYVPPPSYRSPPLHIPNPYLEDTMPKHMSGGHSPQHHP 379
gi 959065362   314 RAPAETVGFQDHYQKEEPIsylakvsePRQDAGIPDSGLEPPVYVPPPSYKSPPHQHVTPHSPSEVPNTNTCTSSDPQGP 393
gi 971381703   312 RAPAETVGFQDHYQKDEPIpylakasePRQDPCVQDPALEPPVYVPPPSYKSPPHHTASPHPLSEVPNNATYASSDQQDT 391
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166218835   377 TEKAGASGQPPSGPPGTGNEYGVSPRL-PQGLPAHPRPVTAYDGFVQYIPFDDPRLRHFKLAQPQGFCEDIKLDdksyns 455
gi 166218820   380 -EKPETSCPLPSGSLAARDLYDAMPGSpPQGLPPQPYPIATHGGSIQYIPFDDPRIRHIKLAQPPEFYEEAKLDdtsynp 458
gi 914919398   384 TEKPGASCPRPSGVVGTGNEYRMSPGS-PRGLPQFPSPVTAHENSVQYIPFDDPRIRHIKLAKPLGFCEEMKLDdrpyhs 462
gi 444732757   387 AEKAGAGCPLPPGPLGTGTEYGAGPRS-PRGLPPHPRLAAAFEGSVQYIPFDDPRIRHIKLAQPQGFYEEAKLGpklwss 465
gi 637309679   394 VETTNFVHPHSVGIFKSGGEHYQNEPT-SYDHKSHPKQVENYLSSVQYIPFDDPRIRHIKIAHTDGLQEDVRAAgdanrt 472
gi 1040190161  361 TEKP----RLPSS--GSGDEYGVGQCS-P------------CPAGVQYIPFDDPRIRHIKLAWPHGDRQDATPEgsscgl 421
gi 348565947   386 TEKPGARGPLPPGLLRTRNECDAGPAS-PQSLPPHPRSVTTHEGSVQYIPFDDPRIRHIKLAQPLGFCEEVKPGdrnyda 464
gi 351713845   380 IEKPRASGPLPPGLLRTGNEYGVSSGS-PQSLRPHPRPVATYEGSVQYIPFDDPRIRHIKLAQPLGFGEEVKSDdrpyda 458
gi 959065362   394 AERVVPCQRPAMNTFEVGGDPCKDNHF-PHGKQSHARRPADHLRSVQYIPFDDPRIRHIKIAPLEGLQGNSNHTenarsp 472
gi 971381703   392 AERAVACQRPAVNSVEMGAAPCKDNHL-PPGKQSHLRRPADYLRSVQYIPFDDPRIRHIKIAPPGGLQDNIKYIdnahsp 470
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166218835   456 SPVTAQEPAhgGMQPDGAIWNpqs-lipPSGDERGLVLADSSPRWLWGQPPGDGENSGLPNQRDRCVARGQWPDVRGSQH 534
gi 166218820   459 GLLTTQEPAigKRQYDDAPSVprg-ptpSPVNEQSSAFVHSSPRWLQGQLPLGIGPGGFHGQTEHHVMGGLTTNVTDIK- 536
gi 914919398   463 GPVTAQEPAhgKMKCDGALVNaqg-pipLSENERSLAFADPSPRWLWGQHPGNGEDGNFSDQRDPGIVREQWTGIRGGQH 541
gi 444732757   466 DLIPPQEPApgEVLRDGAVLSp------qTGYERGATSAQLSPRWLRGHLPRDGEDG-FPEQSDLRVVR-------GSQH 531
gi 637309679   473 SLYAFQGNSl-EPEYNSAFSDmpdslstAVKCDQVPGSSAQSSRWLVEST-IDQDSCALPLQRDS------YDAGNDLNR 544
gi 1040190161  422 GPVAPPEPArnITQLDGAGRNprn-ptpPSGDDRGLAFAEPSPQWLWGQLPRNRDNGGPPDPTDHRITR-------DGEH 493
gi 348565947   465 RPVPAPEPAqeRRHHDSAILNvqs-ltpPLGTERRPTLVDPGPQWLWDQLLGDGKNAGVPDQREHCIVRGQQAPGEGGQH 543
gi 351713845   459 CPVPAPEPAqgKRHRDGAVLNaqs-ltpTLGTGTGPAFVDPGPWWLWGQLPGDGEYASFPYQ------RGQPAPGEGGQH 531
gi 959065362   473 SSGALQERNl-EVQYNSAFVDasn-lssSAKGERTSDSSTHLNRWLAPSI-RDQENCALTDQRDNCRA-TNYSPRNEAST 548
gi 971381703   471 SSGTSQERDl-EVRCNSAFLDash-kssSVKGERTSDSSAHSSRWLAPSV-RDQENCALLDQRDSCST-ANHSPCNEAST 546
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166218835   535 GHTGRQVSSPYSQG-ESTCETQTKLKKFQ--TGTRTKKSSKKKMNETIFCLVSIPVKSESHLPDRDMDNNDLKPSAdqkn 611
gi 166218820   537 --AEGHASSPQPQS-EGTCKTYTKLRKFE--TGVQSKKSSKKKSNATIFCLVSIPVKSESLVLATDTNNNDFKLVAdktr 611
gi 914919398   542 GREEGQVSSPDPQS-ESTWEVQTKLRKFE--TGIQTKKTSKKKMNETIFCLVSIPVKSESHLPDIDTNNNDLKQSAdkkh 618
gi 444732757   532 GHAEGQLSSPDAPG-ERTCEMQTKLRTFE--TGMQTKKSSKKKTSETIFCLVSIPVKSESHLPATDTNNNDLKPTAdrkd 608
gi 637309679   545 KYSKGRLSVQSPHT-QLPCETITKVKTFEpgTEIQSKKSSKKKTNETIFCLVSIPVKSDLNLPDTDRNNN-VTQGAeekn 622
gi 1040190161  494 GHTEGLVSRASPHG-ESLCETQAKLKKSE--TGPELKRRSKKKVNETIFCLVSIPVKSESQLPDTDRNNNDLKQGArqvn 570
gi 348565947   544 GHAGGYVSSPDPQGsERTCETHTKLRMFE--TGMQTKKSSKKKTNETIFCLVSIPVKSESHLPEIDTNNNDLKQSAdkkp 621
gi 351713845   532 GHAGSHVFSPDPQRsERTCETQTKLRMFA--TGMQTKKSSKRKPNETVFCLVSIPVKSESHLPAIDRNNNDLKQSAdqkp 609
gi 959065362   549 EYTKGKLSVRNSHM-DNTCETVTKVKKFEpgTGMQSKKSSKKKMNETIFCLVSIPVKSESNLPDTDRNNN-ITQSPdknr 626
gi 971381703   547 EYTKGKLLVRNSHM-DSTCETVTKVKKFEpgTGMQSKKSSKKKMNETIFCLVSIPVKSESNLPDTDRNNN-ITQSPdkng 624
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166218835   612 gsdkspALQEQSLLSMSSTDLELQALTGSMGGRTEFQKQDLGEPEEDRQTNDLSFIHLTKHRELKHSGSWPGHRYRDQQT 691
gi 166218820   612 glcqgsALQEQSLLSMSSTDLELQALMGSMAWRRTSPRQGLRESE-DGQIDDPRILHLIKPKELQASSPWPGHQYRDQQT 690
gi 914919398   619 rvdkstALQEQSLLSTSSTDLELQALTGSMVGRTEFTKLDLGEPEEDKQTHDLRFIHLAKHREFKYSSPWPGHQYKDQQT 698
gi 444732757   609 gcdksaALQEQSLLSLSSTDLELQALTGSMVGGTGFRKQDLGEPEVHKQTNDLRFIHLTKHRELQASGFWPGHQYRDQQT 688
gi 637309679   623 gldnsgVLREQSLLSTSSTDLELQALTGSMTNKNELQKQESWKPK-FKQMNDLRFLQPAKHKELQYSGSWPGDQYKDQQT 701
gi 1040190161  571 g-------adkspLSASCTDLELQALTGSLVGRPALCTQAPGEPEKDRHANDLRFLYLTGHTELTYPGVWPGHQYRDQQT 643
gi 348565947   622 gidkslALQEQSLLSMSSTDLELQALTGSMAGKTEFPKQDQEEPEGDKQTDDFRFIHLAKHRALKYSGSWPGNQYRDQQT 701
gi 351713845   610 gadkslALQEQSLLSLSSSDLELQALTGSMAGQTEFPKQGLGVPG-DRHADELRFIHLAEHRALQYSGSWPGHQYRDQQT 688
gi 959065362   627 f-dnngALQEQSLLSMSSTDLELQALTGSMTNKNELQKQELWRPEEFKQMNDLRFIQPTKHRELKYSGSWPGDQYKDQQT 705
gi 971381703   625 f-dnngALQEQSLLSMSSTDLELQALTGSMTNKNELQKQELWRPEEFKQMNDLRFIQPAKHRELKYSGSWPGDQYKDQQT 703
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166218835   692 QTSFSEEPQSSQLLPGAKLGGPSRAAL-SPKCSDPAA-SEAQTHTAFPTGDHKQRPSARNLKGHRS-LSPSSNSAFSRTS 768
gi 166218820   691 QTSFHEDSKSSQLLPATKPGEASNVAP-TPTCPDTTA-SEVCLHTALAFSDQNQKPSVPHLQGQTS-LSPSRNSAFSRTS 767
gi 914919398   699 QTNFSEESQRSQLLPDENVGGMSNTAP-ASKSIEPPA-SRALLHTALVSGDQNQKPDAHSLKGQMS-LSPSSNSAFSRTS 775
gi 444732757   689 QTSFPEESQGTQLPPGAEHRGPSPSTP-GAKCPEPAA-FEPHVHTALASRDQKQKPSAPSPQGQTS-LSPSSNSAFSRTS 765
gi 637309679   702 QTSFTEDPKVMQLLQGLEHKRSNTTRA-SQVLRDGTS-TTKPTLTVQSADNRQGKQFTSSVKEQGK----ASNSVYSRTV 775
gi 1040190161  644 QTSFPEEPKSSQ--QPTELGAAGHVAP-TPRRADPAA-SDPGTHTVACAS----RDHAQNLQGQASpLSPASNSAFSRAS 715
gi 348565947   702 QTSFPEESKSSQLLPASMLGELSDTAP-MPERLE--A-TGSHRHVPFGSSDQKQKAYAPNLKGQTS-LNPSSNSAFSRTS 776
gi 351713845   689 QTSFPEDSKSSQLLPAARLGDLSDTAP-DPKCLDPTA-SDLPVHVALGSSDPNWKACAPHPKGQMS-LSPSSHSAFSRTS 765
gi 959065362   706 QTSFSDEPESPQFFHGTKPGKPDSSKPlSPKLPGCTAsTMGAEQAGSPSDERGCRQSSYSMKGQTH-LSQSSNSAFSRTA 784
gi 971381703   704 QTSFSEEPKNPQIFHGTKPGQPSSNKPlSPKQLGCTAsTAGSKQTGSPSDDRGCRQGAYGMKGQMY-LSQSSNSAFSRTA 782
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166218835   769 LS---VDQAPTPKAGRSQPCVDVHGLGAHPGPKREVVKGEP-T-GPCNSKQLFGQFLLKPVSRRPWDLISQLESFNKELQ 843
gi 166218820   768 SA---INQASMSKGTSDQ------LPGANPVPKPEVVKGEStT-GQCNSTQLFGQFLLKPVSRRPWDLISQLESFNKELQ 837
gi 914919398   776 SS---VNQALVPKVGQSQPCVGVQEHEAHPAPKPEVVKGEPmA-GPCNSKQPFGQFLLKPVSRRPWDLISQLESFNKELQ 851
gi 444732757   766 WS---VNQAPVSKACPREPCADVRVPAASPGPQREVVKGEP-T-GPCNSQQLFGQFLLKPVSRRPWDLISQLESFNKELQ 840
gi 637309679   776 --------VLNPKASPNLPPASSATFPGQEKDSNSVFVEEE-S-TLSRSKELFGQFLLKPVSRRPWDIISELESFNKELQ 845
gi 1040190161  716 SSsssTTWAPAAKAG---PSVDGR------APQPEVVKGET-AaGSCNSQQPFGQFLLKPVSRRPWDLISQLESFNKELQ 785
gi 348565947   777 PT---TSQAPVLKAGQPHPCLDVRGQGASPVPKPEVVKGEPtA-GPCNSKQLFGQFLLKPVSRRPWDLISQLESFNKELQ 852
gi 351713845   766 PS---ATQAPVPKAGQTQPCMDVRGQGASPVPKPEVVKGEStA-GPCNSKQLFGQFLLKPVSRRPWDLISQLESFNKELQ 841
gi 959065362   785 PS---VLQSPSPKAHQSQP-VPVQERENGLLSKGDVVKGEP-G-APCNSKEPFGQFLLKPVSRRPWDAISELESFNKELQ 858
gi 971381703   783 TS---IPQASSPKGHQSQP-LPTQEREAGLPPRADVVKAEA-G-APCNSKELFGQFLLKPVSRRPWDAISELESFNKELQ 856
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166218835   844 EEEESss-ssSSSSSSSEESEAEPQQENRAHCRQEDVGFRGNspemrv----epqprmWVPESPVCRSGRGE------SK 912
gi 166218820   838 EEEES------HGGSGSEDSEAE-QPEDCADSRTKSWALQGTrtaq--------qpagLALEN-VASPDRRL------ND 895
gi 914919398   852 EEEES-------YNSSLEESETEQQQEDYADSGPRNQGFHENkeqq---------prvLVPEDSGFHLGRII------SR 909
gi 444732757   841 EE--Ee---eEDSHSSSEDSEAEWLQEDPADPRPESSGFHRHgqevrv----eqeprmLVPEDP-AWLGRVQ------SK 904
gi 637309679   846 ----Ee---eESSEDGIENDGRQEREKEEKIGRKESVAFRNDemsqepdhrlgtqsepLIAVTPVCAQDKDKsrsesvSA 918
gi 1040190161  786 EEEEShpdsdGRRGSGSEGSEGQGPWEDGDPSLEKHPGFPEShreere----erqpkaWGPQHPEFRSGGAK------SQ 855
gi 348565947   853 EGEDSp---dGSSGSSGEENEIE-RQEDYVDSRPRNWGFYEDseksvk-----pppreLVLEHPERWSGRVK------SK 917
gi 351713845   842 EEEDSp---dGSSGSSSEENEIEQRQEDCVGSRPRSWGFHEDscdgrg----eqqprrLVLEDRGGWWGRVE------RG 908
gi 959065362   859 GQEES-----TSSEEDLE--SAAAPLQAGAFMQRRESRNEKSsqepkh----ggksemVVPEVPVFRSGRVK------SK 921
gi 971381703   857 GQEES-----MSSEEDLE--SAGASPQPCALPQRRSPRNGnqepkr------ggkletVVPEVPVFKSGRVK------SK 917
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166218835   913 SESWSEELQpghp--rawPPS-P-GRFRVEeGGGAPFCSADGSTSAEKRHLEVSNGMDELAGSPFPVTR-MSSRSSDAKP 987
gi 166218820   896 SQSWNEEPKpghs--svhPQS-L-GPSQEEgSRGVPVQWADGSLTAEQKSQEDLNGMCERDFSPRPVSRiA---PIDTKA 968
gi 914919398   910 FESWSEEPNpghp--carPQF-P-GPLQVEdSRIGPFQLADGGLLTEKERQKVVNGMNEQLISPGPVKRmMSSRPSDTKP 985
gi 444732757   905 PESWSGEPKpglp--haqPQS-S-GPTQGGdGRGEPWQSVGWSPATEERRREDGSGESRLALSPGPEKGrVSSRSSDTKP 980
gi 637309679   919 SESSNTRVTggef--hvsSRC-L-QAREI----GESTKVTNGYLFAEPKKQEAGKRIIKHAVSPQTTKRiLSDSYDDENH 990
gi 1040190161  856 SGGWSEQVApgwp--qacPRS-PrGPPQAEdGRGAVFLAADGGAIIEKRDQAEGRSAREPVHSPSPPRRaESSRASDAWP 932
gi 348565947   918 SESWSEELKaghl--stcPQS-P-DFSKVKdSRSDPFGSADGSLVTENRKQEIVNGLDELIARPGPVKRvVSFRQSDTKP 993
gi 351713845   909 CETWSREPGaghp--lahPPS-P-GFSQVEdGRGQPFGSAGGSLVTETREWAMVNGTDGPPGGPGPGRRgASSRASDTRP 984
gi 959065362   922 SESWSMGTEhgseprcvgSQGsS-KPg----GSSEGVRPADGSLITEMGMGEAKSRTSKQPVHVGPVKRvLSSSPSSSCH 996
gi 971381703   918 SESWSTGIEhgaemdcvgSQCsS-QPg----GSNEGVRPADGSLITEMRTEEAKNRANSQPVRPGPIKRfLSSSPSSSYH 992
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166218835   988 LPASYPAEPREPQESPKITS-----AFSSVKPSEAVPRKFDSGGERGAGLP--LSLSNKNRGLSAPDLRSVGLTPGQEQG 1060
gi 166218820   969 APLYCLSEPRGSQELTKFGD-----AVGSVQLGRETPTQVGNGGDTEVLPCvlLPLADKYRGHSTPDFRSLELTLGQEQN 1043
gi 914919398   986 APLSYLAESKEPPESLKLTN-----ALSSVQLNKGVSLKND-GKEKDTVVP--LSLTVKNRGLSAPDLRSVGLTMGQEQN 1057
gi 444732757   981 SLLSYLAEPREPQDSWEFTS-----AVSSTRPSHMLPRTAD-GEERGTAVP--LSFTDKSRGLSAPDLRSLGLPAGQEQE 1052
gi 637309679   991 YNPFNSFNFRDESHVKNES------VVDFDRLKKNAAPRINLALERGSATR--LSLTNRSQGLSEPDLRSVGLDEDQGPG 1062
gi 1040190161  933 AAPACAAGLREPTRD-----------ASALRVSGAAPPEAG-----ETPAP--LPLAARSRGLSAPDLRCVGL---REQH 991
gi 348565947   994 VSPSWLAEPKEPAQREKLTD-----AFTSVQLREEAPLEVGLAEERGTGVP--LTLTNKSRGLSAPDLRSVGLIMRPEPS 1066
gi 351713845   985 VPPAWLAAPREPAESERLTDewlpgALGSVWQSGVVPPELPGAEEGATEAP--LTLTSKGRGLSEPDLRSIGLMMRPEPS 1062
gi 959065362   997 SNPFNNLVLQEMSEDQN--------YLEFVKLSKGATPTNDKVLERGSVVR--LSLTKRNQRCSEPDLRSVGLDVAPELG 1066
gi 971381703   993 GNPFNNPVLQEMSEDQN--------YLHFVKLSKGAAPQNDTQLERGSAVC--LSLTKRNQGCSEPDLRAVGLDTAPGPG 1062
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166218835  1061 ASELEGSLGEASTIEIP--PGESLQARAARILGIEVAVESLLPGIRRAGQNQPAEP--DASACTPESPQEELLSRPAPAD 1136
gi 166218820  1044 AYKLE-CLDLENTVEVL--PSESLQERAERILGIEVAVESLLPSARRTEQSQLPEP--DASACNPSSSREDSSHSLALPV 1118
gi 914919398  1058 VSKLDGSLGKGRATEIP--QEESLQERAERILGIEVAVESLLRGT-RTGQNEPPKS--DTSACSPESSKEKSLPSSVPSD 1132
gi 444732757  1053 TPGLDGTLGEARAVAAP--PSESLQARAARILGIEVAMESLLPGARKEGQSQLPEPvtNTNTCSPGPCMEELPVSPAPAG 1130
gi 637309679  1063 TCELD-CYGKPIVPEIP--PNESLQARAARILGIEVPVEALVPNN-RTIQDKNLHS--DNFSLKLSAERTLGDMT----- 1131
gi 1040190161  992 PIGSDGSWGDSSAAEIP--PGETLQARAARILGIEVAVESLLPDSSRTRQSQRPEP-----------PREASQASSAPSD 1058
gi 348565947  1067 TSELDRPLGESTAAEIP--PSESLQARAARILGIEVAMESLLPGTRTAGLSQSPEP--DASTCSLEPLREESSPSSAMSF 1142
gi 351713845  1063 ASKLDRPLGEGRAAVIPpsPNESLQARAARILGIEVAMESLLPGTGTAGPSQSTEP--DTSVCSLEPPREGPLPS----- 1135
gi 959065362  1067 ANNSD-HSSDANAVEIP--VNESLQERAARILGIDIAVESLLPDD-HVGPHPSTSP--SNGAQDFESSTIGSIVN----N 1136
gi 971381703  1063 ASNSD-HSSNANSVEIP--VNESLQARAARILGIEIAVESLLPDD-HVGPQPGARP--ASDAHDFGSSAE-STVS----G 1131
                         1210      1220      1230      1240      1250      1260      1270      1280
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166218835  1137 VPRVSTDAFYGRRKCGWTKSPLFVGDRDSARRAPQAFEHSDVDGVVTSTDpvPEPEPSPLESKFFEQKDVETK------P 1210
gi 166218820  1119 GPKVATDAFYGRRKCGWTESPLFVGE-----RAPQASICSDVDGFPTSQAtsPEP----------GKKDEEAK------A 1177
gi 914919398  1133 APLVTTDAFYGRRKCGWTESPLFVGER-----APQTCEPLNVDGVLTSQPtsPEPQPNHLESKSFEPKDVGAK------P 1201
gi 444732757  1131 GPPAPADAFYGRRKCGWTQSPLFVGERDGARRAPQASEHMGVDGL---RApsPEPQPDPGELKTFDPKDEEAR------P 1201
gi 637309679  1132 --ETKVTSFEGRRKCGWTESSFFVG-----------------DNISLESTedQIPGEETLIAEHFEQHESLSRqredhiP 1192
gi 1040190161 1059 GPTATADAFYGRRKCGWTESPLFVGEREGTRRGPPAPEPSAADGVLAGQVpsPEPQPDALEPKPSECRAGGLA------P 1132
gi 348565947  1143 GPTATTDAFYGRRRCGWTHSPLFVGE-----RAPQASEHSAVDRVPTSQDtsPEPQLGPLESKPLEQNLVEPK------P 1211
gi 351713845  1136 ---VTADASYGRRKCGWTQSPLFVGE-----RAPQAPGHSAVGR----DLasPEPQLGSLESRSSEQKDAGPN------P 1197
gi 959065362  1137 KEGKKEGSYEGRRKCGWTESALFVRAGGRSLYPDEC------------QAthQEASPKPLVTEQVLEQPV---------S 1195
gi 971381703  1132 KEGKKDSSYEGRRKCGWTESALFVGERDRSLYPDEC------------QTthQEGSSKMLVKEQAFEQPV---------S 1190
                         1290      1300      1310      1320      1330      1340      1350      1360
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166218835  1211 PFRSTLFHFVERTPSVAGSEKRLRSPSKVIESLQEKLASPPRRADPDRLMRMKEVSSVSRMRVLSFRNADSqedAEELKA 1290
gi 166218820  1178 PFKSTLFHFMEKSTNVVGPEKRLRNPSKVVENLQEKLVSPPKKADSVHLIRMREVNSLSQMRCLSSKSADSveePDPLKV 1257
gi 914919398  1202 PFRSTLFHFIERTPNVAGSEKRLRNPSKAIESLQEKLASPQRRADPDRLIRMKEVSSVSRMRCLSFKNMDSageAEELNV 1281
gi 444732757  1202 SFRSTLFHVIERTPSVSGPEKKLRSPSKVIESLQEKLASPPRRADPDRLMRMKEVTSVSRMRFLSSKTPDSteeTEELKV 1281
gi 637309679  1193 SLESAVLPFVERQVVPPNAEKKGRNTSKVIETLQGKLAASPSRAAMDRLVRMKEVHSVSRMRRLSIKNTDSgedGEEEKQ 1272
gi 1040190161 1133 SFRSTLFHVIERTPGAAGSEKRLRSPSKVIESLQEKLAAPPRRADPGRLMRMKEVSSVSRMRCLSFQSADRaa------- 1205
gi 348565947  1212 PFKSTLFHVIERTPSVSGLEKRLRSPSKVIESLQEKLASPPRRADPDRLMRMKEVSSVSRMRSLSCRSTESseeAEELKA 1291
gi 351713845  1198 PFRTTLFHVIERTPSMLGLEKRLRGPSKVIESLQEKLASSPRRADPDRLMRMKEVSSVSRMRSLSFRSADPtteAEEAKA 1277
gi 959065362  1196 PSQGEDQTLVCKSAAYQHSEKRVRSTSKVIETLQGKLTSPPSRTAMDRLVRMKEVDSVSRMRRLSIKSADSgeeVDEEKL 1275
gi 971381703  1191 PSQGGDQNLVSKPTVCQHSEKRVRSTSKVIETLQGKLTSPPSRTAMDRLVRMKEVDSVSRMRRLSIKSADSgeeVDEEKL 1270
                         1370      1380      1390      1400      1410
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 166218835  1291 tTRGQAGLPGGLVSPGsgdraqrLGHSLSVSKDSISREEKEHPAAQKEk-SMDQDFWCP 1348
gi 166218820  1258 -IKSSAWLSEGLTSLGgkdeawqAGHLPSVSQ-----NENGHPEVPRDk-MSDQDLWCA 1309
gi 914919398  1282 -PGNQASQPGGPVSLSsgdrswrAGHLPSVSKDVISQEENGHLAGQRErkNTDQGFWCP 1339
gi 444732757  1282 -TRGQAGPPEAFVSLNgrdwarrPGHLLPVSKSIISQEENGHPATQRQrrTAEQDFWGP 1339
gi 637309679  1273 -PKGLDERGSDPTSENnel-prkLSHRSSVSKRIISLAENGLLDNRNEkkTGKHSFSLd 1329
gi 1040190161 1206 ---eEAGQPAGCGSPRggdrahpRGLSSAPARGGVSWEDLGHPAAQRDr-IASEDSWCP 1260
gi 348565947  1292 -ERGQAWQPGGPMALSrgdrawrVGHPPSIPKGIVTWEENGHVASQKEk-STSQDFWCP 1348
gi 351713845  1278 -AGGQALQP-----LSrgdrawrAGPPPALSEGLITWEENGTVAAPREr-SEAQHFWCP 1329
gi 959065362  1276 -------------SKVpeergskLASSGAVSKRVISLSENGCLGGVDKk-KIDRDFSLd 1320
gi 971381703  1271 -------------SKVheergskLAMSGAVSKRVISLSENGYLGGMDKk-KIDRDFSLd 1315
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap