Conserved Protein Domain Family
DUF4597

?
pfam15366: DUF4597 
Domain of unknown function (DUF4597)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 63 and 76 amino acids in length. There is a conserved TPPTPT sequence motif.
Statistics
?
PSSM-Id: 317733
View PSSM: pfam15366
Aligned: 2 rows
Threshold Bit Score: 122.089
Threshold Setting Gi: 831244484
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 327478503 13 MCVSSSNNNHDEAPVLNDKHLSVPNIIITPPTPTGMGLSRDSNKQVWMDELGSYQDDGELEPE 75
gi 831244484  1 MCVSSSSGSHDEAPVLSDKHLDVPDIIITPPTPTGMMLPRDSRRTVWLDETGSCPDDGEIDPE 63
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap