Conserved Protein Domain Family
CABS1

?
pfam15367: CABS1 
Calcium-binding and spermatid-specific protein 1
CABS1 is a family of proteins found in eukaryotes. It is also known as NYD-SP26. It binds calcium and is specifically expressed in the elongate spermatids and then localized into the principal piece of flagella of matured spermatozoa.
Statistics
?
PSSM-Id: 317734
View PSSM: pfam15367
Aligned: 11 rows
Threshold Bit Score: 500.916
Threshold Setting Gi: 348563585
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122137051    1 MAEDGLPKIYSHPPAESTKTTTEATIFFGADNTIPKSETTITSEGDHVTSVNDYMLENDFSTTTgNKLIPPKERQKSEDD 80
gi 81899004     1 MAEDGSPKIYSRPPRDNSKTPTEADIFFGADNTIPKSETTITSEGDHVTSVNDCTPDGDFSTTV-NKLTPTKEKLKLEDD 79
gi 395857230    1 MAEDGLPKMYSHPPTESSRTPTEATILFGADNTIPKSETTITSEGDHVTSVNEYTLESDFSTTTgNKLTPTKEKLKSEDN 80
gi 558189124    1 MAEDDSPKIYSHPPTESSKTITEATILLGTD-TIPRSETPITSEGDHITSVSDYILECDFSTIAnSRLPSPKIRLNSEEN 79
gi 586524767    1 MAEDGLSKIYSHPPTENSKTTTDATTLFGTDNTIPRTETTITSEGDHISSVNDYMLE-NFSTTTgSKLTSPKERLKSEED 79
gi 57095594     1 MAEDGLPKIYSHPPTERGKTTTEATIFFGADNTIPKSEKNITSEGDHITPVNDYTLESDFSTTD-SKLTSPKEKLKSEDN 79
gi 149751645    1 MAEDGVPKIYSHPPTESSKTTTEATIFFGAENTIPRSETTITSEGDHITSVNDHMQESDFSTTTyNKLTSLKERLKSEDD 80
gi 537242848 1463 MAEDGSPKIYAHPPRETSKTPTEAAIFFGADNTIPKSETTITSEGDHITSVNDCTPDGDFSTTA-NKLTPTKEKVKLEDD 1541
gi 348563585    1 MAQDGLPKMYPHPPTESSKVPAEAAVFFGADNTVPKSETTITSEGDHITSINDCMLDSDFSTTTsNKIASTKERQKPEDE 80
gi 109074596    1 MAEDGLPKIYSHPPTESSKTPTAATIFFGADNAIPKSETTITSEGDHVTSVNEYVLESDFSTTTdNKLTPTKEKLRSEDD 80
gi 344284927    1 MAEDGSPKIYSHHPTERNKIPTEATIFFGADNTISKSETTITSEGDHISSANDYTRESDFSSTTgNKMTPPKERLKSEDD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122137051   81 VES-------HLEKEFATLMDIKNPMANESITENFLPVKTGNISSTDA-ISLIDFSTDIAKEDILLDTIDPGDKDV-SLT 151
gi 81899004    80 IEGclk-lttLPEKEITTPTETPNSKPKGSITENFIPVKIGNTSSPVGtVSLIDFSSNTAKEDIFLTTIDTGEKEV-VPT 157
gi 395857230   81 IGThctkpatHLDKEITPLTGTTNSIANDAITENFVPVKIGSISSPVAtVSLIDFSTNIEKEDIVLATINRADEKI-SAA 159
gi 558189124   80 MESyik-sstNLEKEINTLTSTS-SMANDSTTENVIPVKIGNISSPVTsVSLTDFSTSMAKEDILLDTIDPGDKDVpIIT 157
gi 586524767   80 AEShik-sstHLEKEITMLTGTTNSMANDSIMKNIIPVKIGNISSPVAtVSLIDFSTNMTKEDILLDTIDPEDKDV-LIT 157
gi 57095594    80 VGSriiksstHVEKEIATLTGTVNSIANDSITENLIPVKIDNISSPGAtVSLIDFSTNMAKEDILLDTTDPANEDV-SIT 158
gi 149751645   81 AEShilksstHLEKDITTLTGTTNSMASDCITEDFISMKIGNISSPVAtVSLIDFSTNRAKEDVFLDTIGSGDEDV-STT 159
gi 537242848 1542 IEAtlk-sttPQEKEITAPTETTNSKV-ESITENFIPVKMVNISTPVAtVSLIDFSSNMAKEDILLTTTDTED------- 1612
gi 348563585   81 VEAhik-ssaPPEREVTTPTGTMNTTAKEYHSETFIPVNVSKGSSPVAtVSLIDFST-ITKEDILLAAVDVEDEEP-MQL 157
gi 109074596   81 MGTdfiksttHLQKEITSLTGTANSITRDSITENFMTVKIGNISSPVTtVSLIDFSTDIAKEDILLDTIDTGDAEI-LIT 159
gi 344284927   81 VEAhltksttYTEKEMPCLTGTTNPMADNSINENFISPKIGNVSSPLAtVSLIDFSTNLA-EDILLDTTRPGDKDV-SIT 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122137051  152 SEVSGTPKESTAaIADTPILPNIMGKSDVsnySSSVKFKVPADGNAHITDSSVPEAEITPTTERNLTTIPDITALTEEKI 231
gi 81899004   158 TEFSGTLEDSAAdVEDASGFPDESTETDV---PSSATSDAPDDGAVQVTDSFSPEAGVPPSTEKEVTTIPDITNIAEENV 234
gi 395857230  160 SDDSGKVRDSTV-VDDTLTFPDDKGKADGnnyNSSVKSHIPADGAVQGTDSFIPEPKISPSTDENVTTIPDITDLTEEKI 238
gi 558189124  158 SEVSASVKKSTSsVTDIPVLPA-KGELDVhnySSSVKSDVTADEVVQMTDSSIPETEIAPTAEKNFTTIPDITTFTEEKI 236
gi 586524767  158 SEVSGTLKKNIAsITDTPALPAKKNKPNVnnySSSVKSNVTAEEVVQITDSSI--AEISPANEKHFTTLPDITALTEEKI 235
gi 57095594   159 SEVSGTLKEGTTsIADTPNLPAKKDKPDDnnySSSVKSNVTANEAVQITNSSIPEAEISTATEKNF-TIPDITAFTEEKI 237
gi 149751645  160 SEVSGTLKDSTTnTADTPALPAnn-------dSSSVKSNVAADEAVQITDSSIPEAEISPATEKNVTTIPDITTVTEEKI 232
gi 537242848 1613 -ELSGTLQDNPAnLRDTSALPDEKTKTET---SSSTTCNNPDDGAVQVTDSLSPEAEIPPSTEKEVTTTPDITKVTEENI 1688
gi 348563585  158 AEGSDGLAEST----DSPA-PAAKKEADTd----------------KATDSFFPEAEVFPSTEGNFSSIPDITDLTEESI 216
gi 109074596  160 SEVSGTLKDSSAgVADTPAFPRIKDEADMnnyNSSIKSNVPADEAIQVTDSIIPEAEIPPAPEVNFTTIPDITALEEEKI 239
gi 344284927  159 SEVSGEFKKSTTcIADTPILSGKKDAPDVihsKSSDKSN--ADKILQVTNSSIPDVEISSSPKNNVTTIPDITALTEEKI 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122137051  232 TEIDLILPENDPNVVPKLTDSDEEKFITVFELTTTAERDKDNPEDAlLTDEESTDEVSVWMERDMANEEESHSVLLTAVE 311
gi 81899004   235 TEIKLIVSEDRPKTVTKLSDSEEEKFITVFELTNSAEKAKDNVEDP-LNDEESTDGANDWMEKETASEAESHAVLLTAVE 313
gi 395857230  239 TEIDLIVSEDDPNAVAKLSDADEEKFITVFELTASAEKDKDNAEETvLTDEESTEEANVWLERESENEAETHSVLLTAVE 318
gi 558189124  237 TKIDLILPEDDPNSVSKLTESDEEKFITVFEFTTTAKRDKDNPEDIlLPVEESTDGVDVWMERELASEADNHPVLLTAIE 316
gi 586524767  236 TEIDLILPEDNPNAMSKLTDSDEENFITVFELTTTVERDKENQEDVlLTDEESMDGVSVWMEREIANETEDHPILLTAAE 315
gi 57095594   238 TEIDLSLPENDPNPVPKLTDSDEEKFITVFELTTTVERDKDNPEDIlLTNEESMDEVNVWMEKDITNEAENNPILLTAVE 317
gi 149751645  233 TEIDLILPEDDPNVVPKLTDSDEEKFITVFELTTTVERDKDNPEDIpLTDEESTEEINVWTEREIANEAEKYPVLLSAVE 312
gi 537242848 1689 TEIDLIVSEDSPKAVTKLTDSDEEKFITVFELTNSAEKAKDNPEDT-FTDEESTDGANDWMDKETLNEVETHSVLLTAVE 1767
gi 348563585  217 TEVNLVVCQKDPKTVVSLNDTDEEKFITVFELTASAEKHKGNLEET-LSDEEATDEVGVWMQRHRIKGADTNPILLTAAE 295
gi 109074596  240 TKIDLSVLEDDTGAVATLTDSDEEKFITVFELTTSAEKDKDNQEDTlLTDEESPEGANIWMERETATEAETHSVLLTAVE 319
gi 344284927  237 TEIDLILSDEDSDAVAKLTDSDEENFITVFELTTSAEKDKDNPEDIpLMDEESSDEVNVWVERDSPKEAETHSILLTAVE 316
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122137051  312 SRYDFVIPASVTMNLTED--LLTEeDLPENNRMESVTKNTDE----LSGTTPDLDAFSHKEDNFTTETGVFKLLKEEPDE 385
gi 81899004   314 SRYDFIVTASETDNVMEEshVNTT-DLPENETTESVTNVTEE----LPSVTSIVDTLKDKEDLSTTNSGLFKLLKEEPDD 388
gi 395857230  319 SRYDFVVPTPLATNIEEEssTRTTeDFSENNRTDPEAKVTES----FSEATAGPDTPDYKEDTSAAETGIFKLLKEDPDE 394
gi 558189124  317 SRYDFVVPKPIPMNLLEDsaPTMKeDLSENHRVESVTEATEA----FSQTTPDLDNPSQKEDTFTTEMGVFKLLKEEPDE 392
gi 586524767  316 SRYDFVVPKSVAMSLLEDssT-TTkDLSEN-RMESVPKDTEA----FSRTTPDLDTANHKEDTFTTEMGVFKLLKEEPDE 389
gi 57095594   318 SRYDFVIPTSVAMNLTEDssTLTNeDLSENNAIEFVTKDSEP----LSETTPDPDTLSHEEDAFTTEMGVFKLFKEEPDE 393
gi 149751645  313 SRYDFIVPASVATNIKEDssTMTKeDLSENNRMESVSKDTEA----FSGTTPDLDVPNQTEDNCTTETGVFKLLKEEPDE 388
gi 537242848 1768 SRYDFIVPASEATDLMEEptTDTPeDLCENDITESVTKVPEE----FPEVTS-----THKEDSSTPNTGIFKLLKEDPDE 1838
gi 348563585  296 SRYDFRVPASAAVNITGDsaTDTMeDLPENNTTESVPEDTET----LS------DPANYEEDTSAAETGIFKLLKEDPDE 365
gi 109074596  320 SRYDFVVPASIATNLVEDs--sTEeELPETDRTETVPKITEP----FSGTSSVLDTPDYKEDTSTTETDIFELLKEEPDE 393
gi 344284927  317 SRYDFVVPTSVAMNLEDDspTTTTkELSENGRAESVTKVTGPsspiLDAPIPILDASSHLEDNFTTEMDLFKLLGEDPDG 396

                  ...
gi 122137051  386 FLI 388
gi 81899004   389 LMM 391
gi 395857230  395 FMI 397
gi 558189124  393 FLI 395
gi 586524767  390 FLI 392
gi 57095594   394 FLI 396
gi 149751645  389 FLI 391
gi 537242848 1839 LMM 1841
gi 348563585  366 FMM 368
gi 109074596  394 FMI 396
gi 344284927  397 FMI 399
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap