Conserved Protein Domain Family
BioT2

?
pfam15368: BioT2 
Spermatogenesis family BioT2
BioT2 is a family of eukaryotic proteins expressed only in the testes. BioT2 is found abundantly in five types of murine cancer cell lines, suggesting it plays a role in testes development as well as tumorigenesis.
Statistics
?
PSSM-Id: 317735
View PSSM: pfam15368
Aligned: 11 rows
Threshold Bit Score: 215.394
Threshold Setting Gi: 821488470
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1040190112    1 MKPSKNQLAT-NNdTLPNASEVTNKKRQ-LDSPSPHQPKEKPSEKLVHNKIEPMVLRSdPPTNESLAQYSLPVPSSKTRE 78
gi 664754916     1 MKPVKHQLAV-SD-KVVNVPELTNKKGR-PSSPWSSKSKQKRKAKLVRDKLEPMVLRS-PPTGESILRYALPIPSSKTDD 76
gi 532090462     1 MKSAINLSSN-SN-KLASAPEMSQKKGQ-LNLPLLPNRKEKHGAKSVRDKIEPMVLRS-PPTGESVVRYALPIPSSKTKE 76
gi 21312852      1 MKCAKHPSTI-SM-KLTSVPELPYKKGL-LNS--SPKPKEKHNAKSKYGKNESMVLRS-PPTGESIVRFALPIPLSKTKD 74
gi 831220657     1 MNSAKYLLTT-SK-KLASVPELRSSRSVsVKLPSPPYSKRRNSAKVVHDRIEPMVLRS-PPTGGSVVQYALPIPSSRIKD 77
gi 1040116137    1 MKPSKYLQST-SA-ALANVPELMYKKGL-LKAPLSHKLKEKRSGKLVHDKMEPMVLRS-PPTGESLLRYALPIQTSKTQE 76
gi 821488470     1 MKSSKPKTATfAL-GVENSDSASKKAST-LSSG-VYKTRKRSSVKGINEN-ESMILAP-PPVAESMLKHAISIPSENSEN 75
gi 620962567     1 MKPTKQMKCIcGE-TSENA---SKKHSVvLQESPSISTNKKLS---IPEEIEPMIIAS-PPTGECLIRYAIPIPSDNSQ- 71
gi 1046827168    1 MKRANHLSTT-SK-KSTGVPELPHKKGK-LNS--SHKTKEKHNAKPTYEKIEPMVLRS-PPTGESIVRYALPIPSTMTKD 74
gi 752406732     1 MKPAKHLLAS-SN-KLANVPEFTYKKGL-FNLSLSPKPKEKRSAKLVRDKLEPMVLGS-PPVGESIIRYALPIPSSKTKE 76
gi 16552970      1 MKPVKHLLTT-SN-KSANVPALTTKKGL-HNLPLSPELKEKHNAKLIHDKIEPMVLRS-PPTGESILRYALPIPSSKTKN 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1040190112   79 FIMNDEKIKAVTKHLEMLVSTLEETYGPRTKKGEEPIEK---SDNKELN---------LSVGDDMNLFLQRCSHLATQLE 146
gi 664754916    77 FMSEEELIRKITEHLKMVVSTLEEAYGYSIQNGETPIVK---PEQEGST---------LSVGDDLSSFLICCSQFAAQLE 144
gi 532090462    77 LIAEDEMIRKITKHLKVVVSNLEESYGSSVEDGEKPVAK---PGEKELS---------LSVGDDMSSFLVNCSQFAVQLE 144
gi 21312852     75 KISADEMVRRITTNLKMVVSNLEDTYGACYDNGEKAAEK---SEAEG-----------LSIGDDVSSFLLCCSQFTSQLE 140
gi 831220657    78 ILAEDEMLVKITRHLKSIVATLEDAYGADIQSIPKAFVR---SDQEDLC---------LSVGDDLSSFLTSCSHLAEQLE 145
gi 1040116137   77 LTGKDQKIKMITKRLEMLVSTLEETFRLDIQGGEKQNVE---PEQEE-------------VGEDIKSFLMRCSHLAAQLE 140
gi 821488470    76 ILDDEQIVKQVTKRLKEISASLEKTYGLDVKE-ELSVEKipsPEGGEKP---------LTEAEDMTSFLLFCTSLAKQLE 145
gi 620962567    72 MTHDLQMLRQTIDHLSQTVSVMQDVYAITRED-EVIEFQ---DTEDGER---------AFPGDDMTSFFFNCSSIATQLQ 138
gi 1046827168   75 LVSDAEMVRRIAKNLKMVVSSLENTYGVHSDDGEKEEEK---PEEEEEEeeeeeeeeyVSVGDDMNSFLLCCSQFAAQLE 151
gi 752406732    77 LIAEDELIRKITKHLKMIVSTLEETYGFTIQNGEKSVLK---PENEELT---------LSVGDDLNSFLVCCSQFAAQLE 144
gi 16552970     77 LLPEDEMIGKIIKHLKMVVSTLEETYGHCDQNGEEPFVK---HEHEELS---------LSVGDDMNSFLTYCSQFAAQLE 144
                          170       180
                   ....*....|....*....|....*.
gi 1040190112  147 DAVKEEHNVLDTLFKWFQQQVNQMEE 172
gi 664754916   145 EAVKEERNILESLFKWFQRQVNQMEE 170
gi 532090462   145 EAVKEEHDILESLFKWFQLQVNQMEE 170
gi 21312852    141 EAVKEECGALESLYKWFQQQVNQMEE 166
gi 831220657   146 AAVKEEDTILESLFKWFQWQVNQMEE 171
gi 1040116137  141 AAVKQEHNILESLSKWFHGQVSQVDE 166
gi 821488470   146 EAVKEEQQILESLFKWFQREVYHVEE 171
gi 620962567   139 KAVQEEKILLESLNQWFQQEVTLVEk 164
gi 1046827168  152 EAVKEERNILESLYKWFQQQVNQMEE 177
gi 752406732   145 EAAKEERNILESLFKWFQLQVNQMEE 170
gi 16552970    145 EALKEEQNILESLFKWFQWQVNQMEE 170
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap