Conserved Protein Domain Family
KIAA1328

?
pfam15369: KIAA1328 
Uncharacterized protein KIAA1328
This function of this protein family remains uncharacterized. This family of proteins is found in eukaryotes.
Statistics
?
PSSM-Id: 317736
View PSSM: pfam15369
Aligned: 9 rows
Threshold Bit Score: 412.275
Threshold Setting Gi: 556960059
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 971437550   90 DLCPEDKRRIANLIKELARVSEEKEVTEERLKAEQESFEKKIRQLEEQNELIIKERE-AM---------QQQYRECQELL 159
gi 556960059   81 DLCPEDKRRIANLINELARVSEEKEETKERLKSEQESFEKKIRQLEEQNELIVKERE-GL---------QQQYRECQELL 150
gi 823474088  175 DLCPEDKRRIANLIKELARVSEEKEVTEERLKAEQESFEKKIRQLEEQNELIIKERE-AL---------QQQYRECQELL 244
gi 1022991077 107 DLCPEDKRRIANLIKELARVSEEKEVTEERLKAEQESFEKKIRKLEEQNELIIRERE-AL---------QQQYRECQELL 176
gi 1039755838  92 DLCLEDKRRIANLIKELARVSEEKEVTEERLKTEQESFEKKIRQLEEQNELIIKERE-AL---------QLQYRECQELL 161
gi 1034125773  89 DLCLEDKRRIANLIKELARVSEEKEVTEERLKAEQESFEKKIRQLEEQNELIIKERE-AL---------QLQYRECQELL 158
gi 859791339   78 DLCLEDKRRIANLIKELARVSEEKEVTEERFRAEQESFEKKIRQLEEQNDLIIKERE-AL---------QLQYRECQELL 147
gi 940720062   93 DLCLEDKRRIANLIKELARVSEEKEVTEERLKAEQESFEKKIRQLEEQNELIIKERE-AL---------QLQYRECQDLL 162
gi 351714445   79 DLCLEDKRRIANLIKELARVSEEKEVTEERLKAEQESFEKKIRQLEEQNELIIKEREdILfeklffnvqKLQYRECQELL 158
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 971437550  160 SLYQKYLAEQQEQLSLSLSQLSAAKEKe-QKMSGKKSSCQQPPSELDGSYLAVAGPQTLYKNSRASKAgspsraalsqpc 238
gi 556960059  151 KLYQQYLSEQQAKVNYSLSELRTTSPK--QQVLNKKSSSTPASLGLDGSYLGLATEKAHYRTDKGSKS------------ 216
gi 823474088  245 SLYQKYLAEQQEKLSHSLAELSAAKEKe-QKVSSKKSLCHQHSLGLDSSFLGAGGPWTLRKNSRALKAgsparvalsqsc 323
gi 1022991077 177 KLYQKYLSEQQEKLTLSLSELGTGKVKeqQQVPIRKNSPDSPHQEENDAYRNLTSSQN-YQNKNEPKFasqssapetnpc 255
gi 1039755838 162 SLYQKYLSEQQEKLTLSLSELGAARAQe-QQITKKKNTPQCSLMDLDGSFLSVARPQNYGQTKARPKSanqvse--sfte 238
gi 1034125773 159 SLYQKYLSEQQEKLTMSLSELGAARMQe-QQVSSRKSTLQCSSVELDGSYLSIARPQTYYQTKQRPKSavqdsaseslia 237
gi 859791339  148 SLYQKYLSEQQEKLTMSLSELGAARMQe-QQASNRKSTLQSSAMELDGSYLSVAKSQTCYQTKQRPKStnqdsasealld 226
gi 940720062  163 SLYQKYLSEQQEKLTVSLSVLDAARKQe-QQVLNRKSTLPSSSVELDGSYLSVAKPQTYYQTKQRPKnldsas--eplve 239
gi 351714445  159 SLYQKYLSEQQEKLTMSLSELSAARMQe-QQITNRKSTLQSSSVELDSSYLNVAKPQTYYQTKQRPKPanwdsasesfme 237
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 971437550  239 rNNQNYGTEIIYNHQDHP-------------KENPLENglhRKCNNMISSVKQRSPHH-----------VKPAQEMDQKA 294
gi 556960059  217 -RNLGLLTTTYHNGKTELssietgslderqaDRLLLENsfeRTHENLSSEVRWLGRHPhgahrdmdyigGENGKAYDPEA 295
gi 823474088  324 rNNHNYNTEMHYNYQECL-------------KEYPMENdlhRKCNNVISPAKQRSPHH-----------VKQAQEMDQRA 379
gi 1022991077 256 fESYSHRIADLQRPQDGL-------------NREQTEA---RICNLKSPGTRLMGSIL-----------TKRTLPNEMRN 308
gi 1039755838 239 lRNNSLRPITLHHPKEDL-------------ERMSTKT---RTCTYESLGRRLINAAP-----------IEKSLPVELKI 291
gi 1034125773 238 fRNNSLKPVTLHHPKDDL-------------DKIPSQT---TTCNCESPGRKPVDAVP-----------IEKMPQEELHM 290
gi 859791339  227 fRNNSLKPADFHYPETDL-------------DRVPSET---RTCDYGSPGRKLADAVP-----------TEKVPLAELKM 279
gi 940720062  240 fRNNSLKPSALHYPKEDP-------------DLMPSET---RTRDYGSPGKKLADVVP-----------TEKVPSEALKM 292
gi 351714445  238 sRNNSLKPTTLSHPKEGL-------------ERLPSEV---RTCNYESPRRKPMDAAP-----------TETAPPEELKM 290
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 971437550  295 NEFPSMCPPqmtrdcacKHAGSSGGVQKShHVSQVPRRLSGPAH-KTCDYSrlsrvsglnDSRGSGSKETEQAKRLSEER 373
gi 556960059  296 MSCSHLGPL--------RREEKSQSRHQQcLGGRLCDRFCNCESlGARPQC---------EAAELRAGESSHQKRLSEER 358
gi 823474088  380 SEFQSTCPQqvshgcawRHVGSSGNMEEScYVSQVLRKHPGTVH-KTCDHSrhcrgsglnHSTDSGPKETELAKRLYEER 458
gi 1022991077 309 KEFSHLPPYvggycrvqGYPENEEPVHRS-HQAGMTRHHPRTHHcESCSYCglsw--ipcEPVTLGHEEMDDKKQMPVER 385
gi 1039755838 292 KEYPNLPPTpssqycghKCSESGAYVHENyHPTNMAPQCCKTHP-ESCSHCripwasqmhDRVILQPRETDIEKQLSEDR 370
gi 1034125773 291 KECPHLKPTpsqc-cghRLA--ADRVHDS-HPTNMTPQHPKTHP-ESCSYCrlsraslvhGGGALQPNET-LKKQISEDR 364
gi 859791339  280 KECQTLKPIpssqccghRLSENSDPIPES-HPTHIAPQYSRTHP-ESCSYCglswtsrmhGQGTQQSSETDVKKQLSENR 357
gi 940720062  293 KECQHLQPIpsrlccadRLPENADHVPVS-HPTDMAPQYSKTHP-ESCHYCgrswaslmhGQEVLQPSEIDFKKQLSEDR 370
gi 351714445  291 KEWPHLKLTpsrrccghRLSENEDYVHKI-QPTNMTLQYSKTHP-KSCSYCglswvsilhGKETLQPSETEVKKQLSEDR 368
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|...
gi 971437550  374 RQQLLLQKMELEIEKERLQNLLAKQEAKLLLKQQQLRQSQMHY 416
gi 556960059  359 KQKLLLQKVELEVERERLQQLLVEQEAKLLYKQQQLYQSRLNY 401
gi 823474088  459 RQKLLLQKMELEIEKERLQHLLTKQEAKLLLKQQQLHQSRMDY 501
gi 1022991077 386 RKQLLLQKMELEIEKERLQHLLTSQETQLLLKQQQLFQSRLDY 428
gi 1039755838 371 RQQLMLQKMELEIEKERLQHLLAQQETKLLLKQQQLHQSRLDY 413
gi 1034125773 365 KQQLMLQKMELEIEKERLQHLLAQQETKLLLKQQQLHQSRLDY 407
gi 859791339  358 RHQLMLQKMELEIEKERLQHLLTQQETKLLLKQQQLHQSRLDY 400
gi 940720062  371 RQQLMFQKMELEIEKERLQHLLAKQETKLLLKQQQLHQSRLDY 413
gi 351714445  369 RQQLVLQKMELEIEKERLQHLLAQQETKLLLKQQQLRQSRLDY 411
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap