Conserved Protein Domain Family
DUF4603

?
pfam15376: DUF4603 
Domain of unknown function (DUF4603)
This protein family is a domain of unknown function. In particular, this domain lies at the C-terminal end of a protein found in eukaryotes.
Statistics
?
PSSM-Id: 317743
View PSSM: pfam15376
Aligned: 10 rows
Threshold Bit Score: 2000.85
Threshold Setting Gi: 301617779
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 765151317    25 GPLPPSEMSLLQSLGPVQSWLGQELEKCGIDAMIYTRYVLSLLLHDSYDYDLQDQendiflgwekgagkkwgrskkkggt 104
gi 731514401    23 GPGSVSEMSLLHALGPVQTWLGQELEKCGIDAVIYTRYVLSLLLQDSYDYDLQEQ------------------------- 77
gi 483517258    30 GPVSVSEMSLLHALGPVQTWLGQELEKCGIDAMIYTRYVLSLLLHDSYDYDLQEQendiflgwekgaykkwgkskkkc-s 108
gi 301617779    22 GPFSVFEMSMLRALDPVQTWLGQELEKCGIDAMIYTRYVLSLLLHDSYDYDLQEQendiflgwekgackkwgkgkkks-s 100
gi 556981055    22 iPISASEMSLLHALGPVQTWLGQELEKCGIDAMIYTRYVLSLLLHDSYDYDLQEQendiflgwekgtskkwgkgrkkc-s 100
gi 972966340    22 GPFPASEMSLLHALGPVQTWLGQELEKCGIDAMIYTRYVLSLLLHDSYDYDLQDQendiflgwekgtskkwgkskkkg-a 100
gi 1033837602   24 GPVSSSEMSSLQSLGPVQSWLGQELEKCGIDAMIYTRYVLSLLLHDSYDYDLQDQendiflgwekgaakkwgkskrkggt 103
gi 597757842    25 GSLPPSEMSLLQSLGPVQSWLGQELEKCGIDAMIYTRYVLSLLLHDSYDYDLQDQendiflgwekgtgkkwgksrrktgt 104
gi 768923849    25 GSLPATEMSLLQSLGPVQNWLGQELEKCGIDAMIYTRYVLSLLLHDSYDYDLQDQendiflgwekgtgkkwgkskkkggt 104
gi 657576679    25 GPLPASEMSLLQSLGPVQSWLGQELEKCGIDAMIYTRYVLSLLLHDSYDYDLQDQendiflgwekgtgkkwgkskkkggt 104
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 765151317   105 dlsleemkkqaavqclrsasdeNSGIESLVEELCTKLKDIQNKQk------eEKRIQKKSDGSQSP-ERVESPSSKDQVE 177
gi 731514401    78 ----------------------SSGIETLVEELCSRLRDLQSEQ--------EEKIHKKLEGSPSP-EAETSPTARDQVE 126
gi 483517258   109 dltleemkkqaavqclrsasdeSSGIETLVEELCSRLKDLQSKQ--------EEKIHKKLEGSLSP-ETDLSPTAKDQVE 179
gi 301617779   101 dlsleemkkqaavqcllsasdeTSGIETLVEELCSKLKDLQSSQgeqqpinkEEKNNRKLEVSLSP-E--TTCLAKDQAE 177
gi 556981055   101 dlsleemkkqaavqclrsasdeSSGIETLVEELCSRLKDLQNKQk-------EEKISRKAEGSQSP-EVGSSPTAKDQVE 172
gi 972966340   101 dlsleemkkqaavrclrsasdeSSGIESLVEELCSKLKDLQNKQk------eEKQTNKKSEGSQSP-EPDESPSSKDQVE 173
gi 1033837602  104 dlsleemkkqaavqclrsasdeNSGIESLVEELCSKLKDIQNKQke-----kEKHGIKKSDISQSP-EPDESLSSKDQVE 177
gi 597757842   105 dlsleemkkqaavqclrsasdeNSGIESLVEELCSKLKDIQNKQke-----kEKQTSKKSDGSRSP-ELAESPSSKDQVE 178
gi 768923849   105 dlsleemkkqaavqclrsasdeNSGIENLVEELCSKLKDIQNKQk------eEKQIGKKSDGCQSP-ERADSPSSKDQVE 177
gi 657576679   105 dlsleemkkqaavqclrsasdeNSGIESLVEELCSKLKDIQNKQk------eEKQIQKKSDGSQSPpERAESPSSKDQVE 178
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 765151317   178 MYYEAFPPLSEKPVCLQEIMTVWNKAKASSY--SSSSSAAPQTSTDTSSPKD-NSEGETTKERNSEACGIittvtNERGQ 254
gi 731514401   127 MYYEAFPPLSEKPVCLQEIMTVWNKSKVCSHssSSSSSTAPPASTDTSSPKDgHSESEAARERGRGAPCS-----AHETA 201
gi 483517258   180 MYYEAFPPLSEKPVCLQEIMTVWNKSKVCSYssSSSSSTAPPTSTDTSSPKDcNSESEVTKDRSNKVPATv----QERTQ 255
gi 301617779   178 MYYEAFPPLSEKPVCLQEIMTVWNKSKICSYssSSSSSTAPQTSTETPSPKEcNSECETTTIGKSGALNTv----QGKNS 253
gi 556981055   173 MYYEAFPPLSEKPVCLQEIMTVWNKAKVCSYssSSSSSAAPQTSTDTSSPKDcNSESEATKERAHEASATi----NERTQ 248
gi 972966340   174 MYYEAFPPLSEKPVCLQEIMTVWNKAKACAY--SSSSSTAPQTSTDTSSPKDcNSEGEAGKEKNDACCAP-----SERPQ 246
gi 1033837602  178 MYYEAFPPLSEKPVCLQEIMTVWNTAKACTYs-SSSSSAVPQTSTDTSSPKDcTSEGEAFKDRTVDAPSSts-ttSEKAQ 255
gi 597757842   179 MYYEAFPPLSEKPVCLQEIMTVWNKAKACTYs-SSSSSAAPQTSTDTSSPKDcTSEGEVFKDKGSDAFSTsa--tSEKAQ 255
gi 768923849   178 MYYEAFPPLSEKPVCLQEIMTVWNKAKACAYs-TSSSSAAPQTSTDTSSPKDcNSEGEGTKEQNPESGGTvttviSERGL 256
gi 657576679   179 MYYEAFPPLSEKPVCLQEIMTVWNKAKACAYs-SSSSSAAPQTSTDTSSPKDcNSEGEAAKERNLEACGTittatNERGQ 257
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 765151317   255 QRRSKKEKENRYQGGAs--AEDKSTVHlKRQNRHRSEGKYRPRSWSSGSSEAGSSSSGNQGDSRSSKnKNVRMRHKSREa 332
gi 731514401   202 PGRSWSEKESKLSSGM---PEELPASY-KKQARHRPEGKARPRSWSSGSSEAGSSSSGTQGEPRVPT-KCVKVRHRARE- 275
gi 483517258   256 QKKSKNEKENKFSNNA---VEDKPVLY-KKQVRHKAEGKMRPRSWSSGSSEAGSSSSGNQGEYKASM-KCIKVRHKTRE- 329
gi 301617779   254 QRKSKNEKENKFNKGA---TEEKFGL--SKSVRHKSSGKIRPRSWSSGSSEAGSSSSSHQGDMKT---RFIKVRHKVRE- 324
gi 556981055   249 LKRSKKEKENRFSNNL---AEEKLPIS-KKQVRHKSEGKMRPRSWSSGSSEAGSSSSGNQYELKPPI-KFVKVRHKIRE- 322
gi 972966340   247 QRRSKREKENRYYNSV---VEER-AVQsKKQIRHRSEGKLRPRSWSSGSSEAGSSSSGNHREMRTPI-KSVKIRHKSREt 321
gi 1033837602  256 QRRTKREKENRFHGSAtgmPDDQVAPHsKRQARHRSEGRFRPRSWSSGSSEAGSSSSGNQGD-QAPScKSVRIRHKSREv 334
gi 597757842   256 QRRSKKEKENRYHVGAtgvSDDQVTYQiKRQARNRSDLGHRPRSWSSGSSEGGSSSSGNQ-DTKTSNsKGVRIRHKSREv 334
gi 768923849   257 QRRSKKEKENQHHSFVs--AEKKSSAHsKRQMRQRSEGKYRPRSWSSGSSEGGSSSSGNQGDVKTSRsRTVRVRHRSREa 334
gi 657576679   258 QRRCKKEKENRyhg--gaaAEEKSTVHsKRQIRHRSEGKYRPRSWSSGSSEAGSSSSGNQGDSKSSRsKTVRIRHKSREa 335
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 765151317   333 -GKNKRTRNs-GQVKLQAKVIDKEERRNPGGSSTAAIGGAasKQsQLYKKGKRPLKEI-RKDPGCLEPKESGVEARNKKE 409
gi 731514401   276 -ARNKKGRS--GQSRFPAKSGEKAERGVRTGSSSSSGGGS--IK-QLCKRGKRPLKEPgRRDSGGTEGKDLCVESRSDRE 349
gi 483517258   330 -VRNKKGRN--GQSRLAVKSGEKADRKVHSGSSSSSSSGS--IK-QLCKRGKRPLKEIgRKEAGGNDGKDLYLDSRNEKE 403
gi 301617779   325 -VRNKKGKS--GH-KVPTKNAEKVEKKNVVGSSCSASS-----VrPLCKRVKRHVREHaWKEPE-DEGNEVFGDRKTETE 394
gi 556981055   323 -NRNKKGRN--GQVRLSMKTFEKEEKKN--GGSSSSSSGP--IKhQFCKRGKRPLREArRKDASSYESKDFCFESKSEKE 395
gi 972966340   322 -SRNKRGRN--GQVKLALKAFDKEERRNTGGSSSSSGP----TKqQLNKKGKRPLKEI-RKESVCGEIKELAFEARN-KE 392
gi 1033837602  335 sGRNKKGRSggGQVKLALKVIDKEERKNARGNMSTTGGPPk-QQqHYMKKGKRPLREI-RKDANLVEAQESGGEA-SKKE 411
gi 597757842   335 gSRSKKGRSs-GQVKLALKAIDKEERRNTASSCGAAEAPSrqQQqHYTKKGKRPLREI-RKDPSWAQVKESGGEAGNNKE 412
gi 768923849   335 -TKNKKTRNs-GQ----VKVTDKEERRHAGGSSSSTSGCPv-KPpQFYKKGKRLLKEI-HKDPGWKEAKEATLEALKKKE 406
gi 657576679   336 -AKNKRTRNs-GQVKLQVKVIDKEERRNAGGSSSSATGGAa-KQpQLYKKGKRPLKEI-RKDPGWVEAKESGVEARNKKE 411
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 765151317   410 YMEEPLWYTEPITEYLIPFsSHQSKLETKYRSKedfADGYDLTSE-MDRFPDNIQGVCIASESyQRAYIAAGSFVDGHFV 488
gi 731514401   350 YKEEPLWYTEPIAEYFIPS-SRKSKLETTYRHR---PELSALTPEaGGELSEAVHGLCVSSST-HKTYLTAGTFIDGHFV 424
gi 483517258   404 YKEEPLWYTEPITEYFVPL-SRKSKLETTYRNR---EDICGVTSEaVEELSESVHGLCISNNNiHKTYLAAGTFIDGHFV 479
gi 301617779   395 YREEPLWYTEPITEYFVPI-NSKSKLETTYRKSq--QNLYNRSED-IEELSEFVHALRLSNHNiHQTYLTAGTFIEGHFV 470
gi 556981055   396 YKEEPLWYTEPITEYFVPL-SRKSKLETTYRNQlgtDDITSASAA-VGKLSDSMHGLSLSNNNiQKTYLAAGTFIDGHFV 473
gi 972966340   393 YKEEPLWYTEPITEYFVPL-SRKSKLETKYRNRldsHDVFSASTD-VEKLSERMQGICIANTNfQRAYLAAGTFVDGHFV 470
gi 1033837602  412 YMEEPLWYTEPIAEYFVPL--SRSKLETKYRSKedsSNDLAMSID-VDCLSERIQGICIANSCfQRAYLAAGTFVDGHFI 488
gi 597757842   413 YMEEPLWYTEPISEYFVPL--GQSKLETKYRSKpdsPNDLATSID-MDCLSERVQGICIANSLfQRAYLAAGTFVDGHFV 489
gi 768923849   407 YMEEPLWYTEPITEYFVPFsSRQSKLETKYRSKadfPEGFALSAD-METLPEKIQGICIASEGyHRAYLAAGSFIDGHFV 485
gi 657576679   412 YMEEPLWYTEPITEYFIPFsSRQSKLETKYRSKvdsPDGFAMSTD-MERLPERIQGICIANENyQRAYLAAGSFVDGHFV 490
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 765151317   489 EGLVEAedESAGLIGTLSCPQPEERKDLDDKHLSEFTDFYEVDIYQSMLDTSASDSIQ-ESRILSMIRQKSREQGEVEAG 567
gi 731514401   425 EMPAVG--EAADLPGTSFCSPPEDNKYLDDIHLSELTHFYEVDIDQSMLDPGASETVRgESRILNLIRQKGSERTGFEAE 502
gi 483517258   480 EMPAVLn-EDIDLAGTSICSQPEDDKYLDDVHLSELTHFYEVDIDQSMLDPGASDTMQgESRILNMIRQKSKEKTDFEAE 558
gi 301617779   471 EMPAVVn-ETSDHTGTSNCSLFEDN-YLDDVHPLELTHFYEVEIDQSMLDPGASEEMQgESRILNMIRQKSKVKSDFEAE 548
gi 556981055   474 EMPAVId-EADNLSGTSCCSQAEDNKNLDDIHPSELTHFYEVDIYKSILDPSASDLLQgESRILSMIRQKSKEKNDFEAE 552
gi 972966340   471 EMPAEI--EAADLNGTSSCPQPGDSRDLDDEHLSEFTHFYEVDIYQSILDPSASDSVQ-ESRILSMIRQKSKEQRDFEAD 547
gi 1033837602  489 EMPGEGdeEASELNGIPSCPPPEDGQDLDDEHLSEFTHFYEVDLYQSILDPSASDAVQ-ESRILSMIRQKSVERKHFEAG 567
gi 597757842   490 EVSGEGneEATELNGTSSCPLPEDGQDLDDEHLSEFTHFYEVDIYQSILDPSASDAVQ-ESRILNMIRQKSGEPREVEAG 568
gi 768923849   486 EGPGEGedETSELIGTSSFPQQEDSRDLDDEHLSEFTHFYEVDIYQSILDTSASDSVQ-ESRILNMIRQKSKEQRDVEAD 564
gi 657576679   491 EGPGEAedETAELTGTSSCPQPEDSRDLDDKHLSEFTHFYEVDIYQSILDTSASDSIQ-ESRILSMIRQKSKEQRDIEAE 569
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 765151317   568 CCLVLDGLEQQGKSAIRADSQEASGSVGFLME-DLENMVQVWGCYSpSTSEDVDGESFIGDSPVRLSPLLDSVSFTLSKL 646
gi 731514401   503 CCIVLDGMELQGERAIWTDPASAGGAEGLLLQaGAGNLAQFWDGCS-SSSGDADAESFGGDSPIRLSPLLDGAMHNSDLL 581
gi 483517258   559 CCIVLDGMELQGESAIWTDSTSSVGAEGWFLQ-DLSNLAQFWECCSsSSSGDADGESFGGDSPIRFSPILDSTMLNSHML 637
gi 301617779   549 FCRVLDEKRLQGESAIWSESTSSVGADGLFFQ-DHSNLAQFWEPCSpSSSVDADGESLGGDSPNAFSPFLDSTKLSTHSH 627
gi 556981055   553 CCIVLDGLDLKGESAIWTDSYSSVGAEGLFMQ-DLGNIAQFWECCSsSSADEADGESFPGDSPIRLSPILDDTVFSKTGF 631
gi 972966340   548 CCVVLDGLELQGESAIRADSHGSFGADGFFLQ-DLENIAQVWECYSsSSSEDIDGESFAGDSPIRLSPTLDNTVFNPSRF 626
gi 1033837602  568 -CVVLDGLELQGESAIRVDSLGASEAEVSITQ-DMENIAQVWECCSsSSLEDLEGESCPGDSPGRLSPVLDSVPFNFSKL 645
gi 597757842   569 CCIVFDGFELQGESAIMVDCLGASGADVTLTQ-DIKNIAHVWECCSsSSSEDLEGESCAGDSPVRLSPVLGSVPFNIGRL 647
gi 768923849   565 CHLVLDGLEQQGKSAIRADSKEALGSVGFLME---ENVAQVWGCYSpSTSEDIDGESFVGDSPIRLSPLLDSVSFTLSKI 641
gi 657576679   570 CCLVLDGLEQQGKSAIRADSQEASGSVGFLME-DLENMAQVWGCYSpSTSEDIDGESFIGDSPIRLSPLLDSVSFTLSKL 648
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 765151317   647 SGNVEepPAPEAtSEPSGLNSScFNLFELQYDSPTFPLPHESLSVGHEnNTDSSSclEPHSNKQSRLLIWTKNSAFDETE 726
gi 731514401   582 TGNHE--LFSDV-HEGSSVNSC-FSVFEVQCSDSVLPFSFETLNLGNE-DTDFSG--NVLGKTQSRLLIWTKNSAFEENE 654
gi 483517258   638 AGNQE--LFSDI-NEGSGINSC-FSVFEVQCSNSVLPFSFETLNLGNE-NADSSStaNILGKTQSRLLIWTKNSAFDENE 712
gi 301617779   628 AGNQD--LFFDA-------SNSyFSVFEVQCSNSVFSLPRERILDDKV-KEESCStvNGFGKTQSRLLIWTKNSAFDENE 697
gi 556981055   632 AGNQE--LFSDA-NEGSGINSSyFSTFEVQYNNSPLQFSFDTLNLGNE-NTDSSSstNNLSKTQSRLLIWTKNSAFDENE 707
gi 972966340   627 PGNQEe-YFSEA-NEAPGLNSScFSLFEVQYDSPTLPFPCDSLTLGHD-TTDSSSciEPLGNKQSRLLIWTKNSAFDETE 703
gi 1033837602  646 SGAYVgsRLQEAsGSSSAPNPY-FSLFEVQYDSPTFSFPCDSLTGGQE-NVDSSSclDPQGNKQSRLLIWTKNSAFDETE 723
gi 597757842   648 PGALGepPLQETsRSTSALNSS-FSLFELQSESSAFPFSCDSLTSSRD-NIDSSSclDPIGNKQSRLLIWTKNSAFDETE 725
gi 768923849   642 SGFVEepAAPEAtSEAYGLNTScFSLFELQYDSPTFSFPRDSLTAVHEnNTDSSSclDPHSNKQSRLLIWTKNSAFEETE 721
gi 657576679   649 SGNLEepPVPEAtSEPSGLNSScFSLFELQYDSPTFSFPRDSLTVGHEnNTDSSSclDPHSNKQSRLLIWTKNSAFDETE 728
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 765151317   727 HCSNLSTRTCSPWSHSEETRSDNEQGNATAEDAAQIGNDENDCA--IPPLPATYRDDQILDFLQEDSVKkCEEVSVSTAS 804
gi 731514401   655 HCSNLSTRTCSPWSHSEETRSDNETLSVQFEESTQFSAEDINYV--VPRVSSNYVDEELLDFLRGEACQ-QNSRTLGEIP 731
gi 483517258   713 HCSNLSTRTCSPWSHSEETRSDNETLNIPYEESTQFNAEDINYV--VPRVSSSYVDEEILDFLPEETCQ-QQARTLGEMP 789
gi 301617779   698 QCSNISTRTCSPWSHSEGTRSDTETFNCHFEEPSLSNIEDPNYV--VPRVALGLQDDE-PSCLNTRSSF-PQKKNLEDES 773
gi 556981055   708 HCSNLSTRTCSPWSHSEETRSDNETFNIQLEESTPFSTEEIKCI--APSFSSCYLEEELLDFLHEETCQ-QKNGALREIP 784
gi 972966340   704 HCSNLSTRTCSPWSHSEETRSDNEQMNIQSEESAQFVTEEINCI--MPSISSRYLEDELLDFLQEDNCH-CGDGKVCSIS 780
gi 1033837602  724 HCSNLSTRTCSPWSHSEETRSDSEQVSAPADESAQFGNEEVSCIslIPPLC---LEEELLDFFQENSSHqQEETSVSAES 800
gi 597757842   726 HCSNLSTRTCSPWSHSEETRSDSEQVGAPADESAQFGGDEIGCV--IPPIPASYLEEELLDFLQENPSHqQDEMSVGTAS 803
gi 768923849   722 HCSNLSTRTCSPWSHSEETRSDNEQANVQTEDSAQMGGEELDCV--IPPLSGTYLEDEILDFLQENSVHkREEVSGSTAS 799
gi 657576679   729 HCSNLSTRTCSPWSHSEETRSDNEQGNAQAEDAAQIGNEEIDCI--MPPLSGTYLEDEILDFLQEDSGRkCEEVSVSTAs 806
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 765151317   805 NQTFTKISKLESVCGIALESN-DS-KQY-STGGfLDNRNQQSEDYSSGIIKDIWTAIGNEKAAISGpGAEK-STKGLFSQ 880
gi 731514401   732 TVLFKKKSKLESVCGIQLEHK-PExRDFeTAHV-CGGGSPPGDSYHSGAMKGIWTHVAGGNPVATL-DTEK-MDGEPFSA 807
gi 483517258   790 TLIFKKKSKLESVCGIQLEQKsES-KDYeTTQG-CSESSPHGDGYSSGVIKDIWTNMTDRNSAAMV-EIEG-IEDELFST 865
gi 301617779   774 TLPLNKKSKLESVCGIQLEQ--EC-HELsDASDaGKASYQGEHGYSSGVIKDIWTSMSDRNSEI--------MDDPLFPV 842
gi 556981055   785 SLVFKKKSKLESVCGIQLEQKgES-KEYeATEVfVGEIGQQGEDCSSGVIKDIWTSLAARDSVGTL-EADR-TEDQLFST 861
gi 972966340   781 SQTLKKKSKLESVCGIPLEKD-ES-KPYgSAGIfTNDIPQQSDNYSSGIIKDIWTSIGDGDSAVTL-EGEK-VDEGLFSE 856
gi 1033837602  801 NQPFNKKSKLESVCGIALEQD-ES-KLY-NAVVfSDVPNQQSDEYTSGIIKDIWMAIGDRDCVLTL-GVKN-TGEHLFSE 875
gi 597757842   804 NQTFNKVSKLESVCGIALEQD-DN-KQY-STALfSDDSNQQNDDYSSGIIKDIWMAIGDRDCVLAL-GVEK-AGENLFSE 878
gi 768923849   800 SESFTKKSKLESVCGIALEED-DS-DRY-STGVfPDNMNQRGDDYSSGIIKDIWTAIGHDKPARSQqGAEK--GEGLFSD 874
gi 657576679   807 NQTFTKKSKLESICGIALEED-ES-KQY-STGMfSDNTNQQSDDYSSGIIKDIWTAIGDGKSVISRqRAEKtS-EGLFSD 882
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 765151317   881 EPSPYcCSCLEDQTKGLPVQRpQKKAVQRSEYHLWEGKK---QEQDLAKNNLSKVGGaGDYMTPSKPWALNSDKETTsFI 957
gi 731514401   808 DVNSY-CCCLDAEAETEALQE-ASKAVQRSEYRLWEGQKgglEKRAFVPSEPAEVDG-GDYTMPSRPWDAVQEKESA-FI 883
gi 483517258   866 DVNNY-CCCLDTEAKVETLQE-PNKAVQRSEYHLWEGQKenlEKRAFVSNDLSKVDG-GDYTTPSKPWDVNQDKENS-FI 941
gi 301617779   843 GVNAY--TGQDAEATDEAFQE-PSKAVQRSEYHLWESQKdpvEKRAFLACE-SEVDC-GDYTTPSKPWEVNHVKENS-FI 916
gi 556981055   862 EVNNYhCCCLDIEAKVDPCQEqQNKAVQRSEYHLWESQKenlEERPFITSEQLKLDG-GDYTTPSKPWHGNPDQESA-FI 939
gi 972966340   857 DTN-YhCCCLDMDGKAGSLQVsQKKAVQRSEYHLWEGQKeclEEQTLIKNELSKVDG-GDYTTPSKPWDVNPDKDNT-FI 933
gi 1033837602  876 DSTSYqCSCLDKDAKGEIIQ---KKAVQCSEYHLWDGQK---ENDGLPKNKLTKMND-GDYTAPAKPWNCNS-QESTsFI 947
gi 597757842   879 ETSSYqSCCLDVEVKGEPIQ---KKAVQRSEYHLWEGQK---EDQGLAKGKVSKIDG-GDYTTPARPWDINSEKDNTsFI 951
gi 768923849   875 ESGGYcCSCLEVQAKGVQIQGpQKKAVQRSEYHLWDSKK---EEQDLAKNKLSSIDGaGDYTTPSKPWDLNSDRESTsFI 951
gi 657576679   883 ESGSYcCSCLEVQAKGVPVQGpQKKAVQRSEYHLWEGKKe---EQDLAKNKLSKVDGaGDYMTPSKPWDLNSDKESTsFI 959
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 765151317   958 LGGVYGELKTLSSDKNWAVVPPSGSHGSLLQCaaa--taSSSDLLTITGKDVFMNKSSCFAPGHRPLWRPLVSFGQSDQA 1035
gi 731514401   884 LGGVYGELKTFSSEGEWAVVPPGPSRGSLLQC-------AASDVVTIAGTDVFMTPGNSFAPGHRQLWRPLVSFEQNDPP 956
gi 483517258   942 LGGVYGELKTFNSDGEWAVVPPSHSKGSLLQC-------AASDVVTIAGTDVFMTPGNSFAPGHRQLWRPFVSFEQNEQS 1014
gi 301617779   917 LGGVYGEFKAFGGDDEWAALPPNQVKEGLLEC-------AASDVVTIAGTDVFMTPGNSCAPGHRPLWKPLISFEENEQP 989
gi 556981055   940 LGGVYGELKTFNSDGDWAVMPPSHSRSSLLQC-------AASDVVTIAGTDVFMTPGNNFAPGHRPIWKPFMSFEHGEQA 1012
gi 972966340   934 LGGVYGELKTFNSDGDWAVVPPRHTRGNLLQC-------AATDVVTIAGTDVFMNTGNCFAPGHKPLWRPLVSFGQCDQA 1006
gi 1033837602  948 LGGVYGELKTLSGDREWAMIPPGDACGSLLQCaa----aTSSDMVTIAGADVFMNTSSCFAPGHKPLWRPIVSLGQNEQA 1023
gi 597757842   952 LGGVYGELKTLSNDKEWAVVPPDEACGSLLQCaa---aaSSSDVVTIAGTDAVVNTGSCFAPGHKPLWRPLVSFGQNDQS 1028
gi 768923849   952 LGGVYGELKTLGGDKSWAVLPPSDGQSNLLQCaas--atSSSDVLTIAGTDVFMNTASCFAPGHRPLWRPLVSFGQSEQA 1029
gi 657576679   960 LGGVYGELKTLSGDKNWAVVPPSDTQDSLLQCaaaaasaSSSDMLTITGTDVFMNTGSCFAPGHRPLWRPLVSFGQGDQA 1039
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 765151317  1036 iRGSGDGMNKGFSLIFHEDLLGSYRGLHSEDQGLEYPFASFNLNNPFSQVLHVECSFEPEDMASFSPGFKPKSILCSDSE 1115
gi 731514401   957 -KSRESGWNKGFSFIFHEDLLGACGNFPVEDPGLECPFSSLGLSSPLSQVLHVECSFEPEGIASFSPGFKPKSILCSDSD 1035
gi 483517258  1015 -KSGDNGLNKGFSFIFHEDLLGACGNFQVDEPGLEYSFSSFDLNNPFSQVLHVECSFEPEGIASFSPSFKPKSILCSDSD 1093
gi 301617779   990 -KNREKGLSKGFSFILHENLLETCANLQIDEPDVGYSFSSFELNNRFSQVLHVECSFEPGCISACSPNFKPKS-FCLDSG 1067
gi 556981055  1013 -KQGEDRLNKGFSFIFHEDLLGSCGNFEGEEPGLEYSFSSFDLTNPFSQVLHVECSFEPEGIASFSPSFKPKSILCSDSE 1091
gi 972966340  1007 vKG-GDGLNKGFSFIFHEDLLGTCSSFRSDEPGLDYSFSSFDLKNPFSQVLHVECSFEPEDIASFSPGFKPKSILCSDSE 1085
gi 1033837602 1024 tKGTGEGLNKGFSVVFHEDLLGSCGGFRGEESGLDYPFSSFDLNNPFSQVLHVECSFEPEDMASFSPGFKPKSILCSD-- 1101
gi 597757842  1029 tKGMGDGLNKGFSFIFHEDLLGSCGGYCGEEQGLDYPFSSLDLNNPFSQVLHVECSFEPEDMASFSPGFKPKSILCSESD 1108
gi 768923849  1030 iRESGEGLNKGFSFIFHEDLLGPYGRLRGEEPGVDYPFASFSLNNPFSQVLHVECSFESEDMASFSPGFKPRSILCSDSE 1109
gi 657576679  1040 iRGGGDGLNKGFSFIFHEDLLGSCGGLHSEEQGLEYPFASFNLNNPFSQVLHVECSFEPEDMASFSPGFKPKSILCSDSE 1119
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 765151317  1116 SEPFHSQMYGINRTQYRAIRISPRTHFRPISASELSPVGVSDSEAETDKEEAGFPALAPVDVFDDPQADLKPLEEDAECE 1195
gi 731514401  1036 GEVFHPRTCGVDRTQYRAIRISPRTHFRPISASELSPGGGSESESESEKEEVSIPIPPQVDAFQDPQADLKPLEEDAEKE 1115
gi 483517258  1094 SEVLHPRICGVDRTQYRAIRISPRTHFRPISASELSPGGGSESEFESEKDEGSIAVPSQVDVFEDPQADLKPLEEDAEKE 1173
gi 301617779  1068 GETGNPRVCGIDRTQYRSIRISPRTHFRPISASELSPVGGSDSDFESEKDEAAVPAVSE-EVFADPQDDLKPLEEDAENE 1146
gi 556981055  1092 NEVFHPRIYGVDRTQYRAIRISPRTHFRPISAAELSPGCGSESEFESEKEDLGIPVLSQADVFEDPQADLKPLEEDAERE 1171
gi 972966340  1086 NETFHPRMYGINRTQYRAIRISPRTHFRPISASELSPGGGSESDLESEKDELSLPILSQTDVFDDPQADLKPLEEDAECE 1165
gi 1033837602 1102 KEPFCPWLYGINRTQYRAIRISPRTHFRPISASELSPGGCSESDVESEKEEASIPV-GQADLFDDPQADLKPLEEDAECE 1180
gi 597757842  1109 NEPFCPRLYGINRTQYRAIRISPRTHFRPISASELSPGWCSVSDAESEKEETSLPVPGQTDLFDDPQADLKPLEEDAECE 1188
gi 768923849  1110 NEAFPSRIYGINRTQYRAIRISPRTHFRPISASELSPGGVSDSEAETDKEESAFPASAPVDVFDDPQADLKPLEEDAECE 1189
gi 657576679  1120 NEAFHPRIYGINRTQYRAIRISPRTHFRPISASELSPGGVSDSEAETDKEEMSFPVLAPVDVFDDPQADLKPLEEDAECE 1199
                         1210      1220      1230      1240      1250      1260      1270      1280
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 765151317  1196 GPYYGKSELESGKFLPRLKKSGMEKSAQTSLDSQEGSSSLLPIAEQETCLDCKTAAAA---SSAGGQTDVSVGKVQREES 1272
gi 731514401  1116 GHYYGKSELESGKFLPRLKKSGMEKSAQTSLDSQEEAAGVLPAGKPSPCVGCSSSETLq-iGLGSSEANCKIMAQCEEEI 1194
gi 483517258  1174 GHYYGKSELESGKFLPRLKKSGMEKSAQTSLDSQEESAGMLPVGNQDPCLECSMKESLdgrAMESSKVNCRIVEPREETS 1253
gi 301617779  1147 GHFYGKSELESGKFLPSLKKSGMEKSAQTSLDCQEDSLGALP-PDKQGNLDFRIIESLesdSVESSKINCKKVEPNNQAD 1225
gi 556981055  1172 GHYYGKSELESGKFLPRLKKAGMEKSAQTSLDSQEGSGGLLPTEDLERCPDCSVQASIk--DTENHKIDCKMIETNEVK- 1248
gi 972966340  1166 GPYYGKLELESGKFLPRLKKSGMEKSAQTSLDSQEGPISLLPIAEQEVCLDCEMEASAgsiKTEASVEELETDEISKEDS 1245
gi 1033837602 1181 GPYYGKSELESGKFLPRLKKSGMEKSAQTSLDSQEGGSTLLPITEQEICVHCEVAADSvpcSHVQSSVLL------QEET 1254
gi 597757842  1189 GPYYGKSELESGKFLPRLKKSGMEKSAQTSLDSQEGGGTSLPTAEPEICLDCEIAGASavaSEAGSCAELPTDTPEKEES 1268
gi 768923849  1190 GPYYGKSELESGKFLPRLKKSGMEKSAQTSLDSQEGSGSLLPIAEQEDCLDC---------SGAGGKTVVSLGQAQKDEA 1260
gi 657576679  1200 GPYYGKSELESGKFLPRLKKSGMEKSAQTSLDSQEGSSTLLPIAEQEICLDCKTAAAA---SNAGGQTDVSVGKIQKEES 1276
                         1290      1300      1310      1320      1330      1340
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 765151317  1273 aaeKQSCLSSPKGPIPKYGmAYDFV-GDVPE-FSLLNIRGQGGTESQQNDCWWQNTICPPLFP 1333
gi 731514401  1195 ---SHFCSCKAGCQFPACE-DNRVSsGELDE-FPVLNADVQGTRRHQEKPTWWGKALFSPLFP 1252
gi 483517258  1254 ----RFCSCKAGCHFPTYE-DNPVSsGELEE-FPILNTDLQRMSGSQEKQCWWEKALYSPLFP 1310
gi 301617779  1226 kggSYEIGCESMCA------------EEMGE-YPSLNIDLQGVNAAQEKQCWWQKALYSPLIP 1275
gi 556981055  1249 ----ELCSCKVACHFPGNNvENCIAaPRLQEqFPSFNVFLHGKNGSQQEECWWQKALFSSSFC 1307
gi 972966340  1246 ----EACKCSEAGQCSTYGkAYEFG-KDLQE----------GSTSSQQEECWWQKSLCPPLVS 1293
gi 1033837602 1255 sgeTEPCNCVATGQIPKSGkSLDVA-QDMHE-FPLLNFGEQCLTNMQQEECWWQSSLCSPLFP 1315
gi 597757842  1269 cveRETCRCDGKSQIPEFEkSYDEApQHLHE-FPLLSFGEQSLGRSQQEDCWWQNSLCSPMFS 1330
gi 768923849  1261 lgeK------PADRVPQYGiPHDFV-GNAPE-FPRINIGGQGGAGSEQSPGWWQNTLGSPLFP 1315
gi 657576679  1277 sgeKQSCLCSPAGQIPKYGiAYDFV-GDVPE-FPLlnisgqggtgNQPDECWWQNTICSPLFP 1337
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap