Conserved Protein Domain Family
DUF4609

?
pfam15382: DUF4609 
Domain of unknown function (DUF4609)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 70 and 139 amino acids in length.
Statistics
?
PSSM-Id: 317748
View PSSM: pfam15382
Aligned: 14 rows
Threshold Bit Score: 101.439
Threshold Setting Gi: 431892450
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 562847481  69 ERPGVKqKAGRKECVIPQIVITRASNETLISYDSTGSEEQRTIREQAEWGPYYRHRAPSTVDAYHPHG 136
gi 731504614  77 EKPEPA-KLSKKKAAIPQIVITCPSNETLLSCGSTEIKEQKTIKEHASWGPLARHRNPSTVDAYSSQD 143
gi 431892450  32 EKPDVKvKSSKK-VVIPQITITTASNETLIG-DTIGSEEQTTIREVAEWGAYSRHRNPSTADAYNLQT 97
gi 755800504 113 EKPDVKvNSSKKKAVIPQIIITKASQETLTSYGSIRSEEQRTIQEQAEWGPYYRHRNPSTVDAYGLre 180
gi 953848171  48 ETPDVK--SSRKQVAVPQIVITRASKETLISYSSIRSEEQTTIQERADWGPYHRHRNPSTVDAYGPQI 113
gi 752428292  39 ENPEVKvKASKERAAVPQIIITRASTETLTSYSSIGSEEQRTIKEQVEWGPYYRHRNPSTVDAYDfqe 106
gi 512962005  40 EKPDVKqKSTKKKGVIPQIIVTRASSETLTSCSSLGSEEQRTIQEQADWGSYSRHRSPSMAAAFNPQA 107
gi 514443527  70 EKPDLK-KSSKKKTVIPQIIITRASTETLNSYDSLGNEDQRTIHEQADWGPYSRHRNPSTAAAFTPQA 136
gi 157818729  67 DKPDTKqRSSKKRSVIPQIIITRASNETLISYGIPDSDEQRTIREHADWGPYYRHRSPSTIAAYEVQN 134
gi 984119452  54 EKPDVKqKSNKKKFVIPQIIITRASNETLISYCSTGNEEQRTIREQADWGPYHRHRNPSTVAAYDLHT 121
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap