3WTF


Conserved Protein Domain Family
PAXX

?
pfam15384: PAXX 
Click on image for an interactive view with Cn3D
PAXX, PAralog of XRCC4 and XLF, also called C9orf142
PAXX is a set of eukaryotic proteins that belong to the XRCC4 superfamily of DNA-double-strand break-repair proteins. PAXX interacts directly with DSB-repair protein Ku and is recruited to DNA-damage sites in cells thus functioning with XRCC4 and XLF to bring about DSB repair and cell survival in response to DSB-inducing agents.
Statistics
?
PSSM-Id: 317750
View PSSM: pfam15384
Aligned: 10 rows
Threshold Bit Score: 214.222
Threshold Setting Gi: 620973303
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3WTF_A        10 LCTLP--PGPEPPRFVCYCEGEESG-----EgdrggFNLYVTDAAELWSTCFTPDSLAALKARFGLSAAEDITPRFRAAC 82
gi 81878389   10 LCILP--PGSGSPRLVCYCERDSGGdgdrdD-----FNLYVTDAAELWSTCFSPDSLARLKARFGLSGAEDIHSRFRAAC 82
gi 74752355    8 LCTLP--PGPEPPRFVCYCEGEESGegdrgG-----FNLYVTDAAELWSTCFTPDSLAALKARFGLSAAEDITPRFRAAC 80
gi 908499599 106 YCTVL--DKTSQSKFLCYTRRKD-G-----M-----LSVCLTDAANVWSVEYTKDSLKHLGQRFALKSTEDYVLKLRAFC 172
gi 973204903  14 HCTVV--PGSDGTKYICYSSRRR-G-----E-----SNIGLTNGSEVWSTEFTPEMLAQHRQRFEMRTAADYILKIRSAC 80
gi 551530612   8 FCTVV--DMKSQTRYVCYSRRKEGG-----Ggg-rrLCVNVTDAAAVWSADCSEDVLKPQGHRPALKSTEDDILRFRTSC 79
gi 194578841  12 LCTLL--DKNDQSKYVFFTQKLPAG-----V-----INIGFTNGEDVWKTHLSEEILSQLFKKFSLKSTEDYTFKIKCAC 79
gi 620973303   1 ------------------------------------------------------mlsssQKSQQGLTPTENYATRFRDAC 26
gi 348574474  10 LCTLP--PGPGPPRFVCYCEPESSEasglgV-----FHLHVTDGAELWSARLPPDSEAARKARCGLDVDEDLAARFRTAC 82
gi 611978484  10 LCMVPasSGQGLPRYVCYWEGPTEPae-trA-----YNLYVTDALELWNTSFTPESLEKHKAQHGLDGAEDYSVWFRVAS 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3WTF_A        83 EQQAVALTLQED--RASLTLSG-GPSALAFDLSKVPGPEAAPRLRALTLGLAKRVWSLERRLaAA-EETAVSPRKSPRPA 158
gi 81878389   83 QQQAVTVSLQED--RALITLSG-DTPALAFDLSKVPSPEAAPRLQALTLSLAEHVCNLERRL-AAaEETITSPKKNTQPA 158
gi 74752355   81 EQQAVALTLQED--RASLTLSG-GPSALAFDLSKVPGPEAAPRLRALTLGLAKRVWSLERRL-AAaEETAVSPRKSPRPA 156
gi 908499599 173 NSGDVSVAVHEV--GAELHLGS-SPEDLSITLSRLEGPQATDKLKELLFTMADSLTQLDSGP-SN-GPPSASPVKNYQRR 247
gi 973204903  81 EGHLASLLVQDS--GITLELGGpGPGALTLSLTRLQDPEGREEIRGLLFSMAERLREVES------TAQSFSPVKTQQRC 152
gi 551530612  80 LSGDVRVVVQHS--RAALHVGS-GPAALSVTLTRMEAPQATEELKELLFTMADTLAQLDS------GSSAVNPFKSLQRC 150
gi 194578841  80 KTGRAFVKLLED--SAVLHLGA-EATDLSLSLAKLTDSEGRMEVKDLLFKMADSLQQLDSQG----ASSSFSPGKGYQKR 152
gi 620973303  27 EQQTVSLTLQDDgsTVSLQLPG-GPSGLTFELPKLPDSEARPRLQALMLELAERVRGLERRL-ADvEAMAASPRKKSCLS 104
gi 348574474  83 QQQAIALSLRED--RASLTLSG-PPSTLTFDLSKVPSPEAAPRLQALTLGLAERVCSLEQRL-AAvEEAAISPRKSPRPA 158
gi 611978484  84 DRHTVSLTLKDDs-SAYLTISR-GAETLTFELSKVPSLEAAPQLQALMLGLAEQACRLEKQL-AAlKDESPSPRKKSQPG 160
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*...
3WTF_A       159 GPQlFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET 206
gi 81878389  159 GTQ-FLPELDHQRGSSGPGVRRRCPGESLINPGFKSKKPAAGVDFDET 205
gi 74752355  157 GPQlFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET 204
gi 908499599 248 PTE-FEPWQQQN-SAPAMTMKKRLPGSSLINPGVKKKQQATGVAFDDA 293
gi 973204903 153 SSD-FEPRRRHNGGGASAAVKKRLPGDSLINPGTKRKKEASGVDFDDG 199
gi 551530612 151 PAD-LKPRQQQN--GAASVTKRRLPGASLINPGTKKKVQATGVAFDDE 195
gi 194578841 153 SAE-FEPKKQHK--GPVVAVKKRLPGDSLINPGTKRKKPATGVAFDDE 197
gi 620973303 105 GQKlFMPDSERRRGGSGPGTRKRMPGESLINPGFKSKKAPSGVDFDDS 152
gi 348574474 159 RPPlFLPDHDPQRGSPGAGVRRRCPGESLINPGFKSKKPASGVDFDEP 206
gi 611978484 161 GQQlFLPDPDSRRSAPGPVMRKWMPGESLINPGFKSKKPASGVDFDAV 208
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap