Conserved Protein Domain Family
FAM60A

?
pfam15396: FAM60A 
Protein Family FAM60A
This protein family, FAM60A is a family of proteins is found in eukaryotes. It is known to be a cell cycle protein that binds to the promoter of a gene transcription repressor complex, named SIN4-HDAC complex. This means that FAM60A has an important role to play in 'switching on' gene expression. Proteins in this family are typically between 179 and 324 amino acids in length.
Statistics
?
PSSM-Id: 317762
View PSSM: pfam15396
Aligned: 19 rows
Threshold Bit Score: 229.537
Threshold Setting Gi: 156368660
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74872681     2 FNFHKPRVYRSADGCCICRAKSSSSRFTASRKYEKESMQCFNLNE--PRNGEICNACVLLVKRYKRLPIGSKRHWGHVVD 79
gi 642915185    2 FSFHRPKVYRSSTGCCICKAKSSSSRFTDSKKYEEDFMKCFKLAE--PRQGEICNACVLLVKRWKKLPAGSDRNWKHVVD 79
gi 749774973    2 FNFHKPKVYRSATGCCICKAKSSSSRFTDSKKYEDDFLECFQLQE--RRTGEICNACVLLVKRWKKLPAGSNRNWRHVVD 79
gi 115772506    2 FTFHRPKIYRSVAGCCICKAKSSSSRFTDSKKYEMEFKNCFNLVEgqQRQGEICNACVLLIKRWKKLPKGTERNWNHVVD 81
gi 1009407246   2 FSFHKPKVYRSSTGCCICKAKSSSSRFTDSKKYEDDFMLCFQLDE--RRSGEICNACVLLVKRFKKLPPGNDRNWRHVVD 79
gi 762078805    2 FSFHKPKIYRSINGCCICRAKSSSSRFTDSKRYECEFEKCFRIRE--KRAGEICNACVLLVKRWKKLPEGTSRHWHHVVD 79
gi 241177521    2 FSFHKPKIYRSALGCCICRAKSSSSRFTDSKKYEPEFARCFRIVEedRRSGEICNACVLLVKRWKKLPPGTTRDWHHVVD 81
gi 1005947203   2 FSFHKPKIYRSISGCCICKAKSSSSRFTDSKKYEAEFEKCFRISE--KRSGEICNACVLLVKRWKKLPPGTARNWRHVVD 79
gi 242023042    2 FSFHKPKVYRSTTGCCICKAKSSSSRFTDSRKYEEDLMECFQLGE--RRTGEICNACVLLVKRWKKLPDGSDRNWRHVVD 79
gi 345484456    2 FSFHKPKVYRSSTGCCICKAKSSSSRFTDSKKYEEDFVKCFQLEE--RRTGEICNACVLLVKRWKKLPAGSSRNWRHVVD 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74872681    80 ARAGPGTKSMAKQ--K-----KRdnadaksr------aangsgnSFLPEKFAK----NRKSKE--RAATEAAAarpssls 140
gi 642915185   80 ARAGPGMKSMSKF--K-----SKn--------------------KKIDENCDKikkkKHFEREysPLSDNEDV------- 125
gi 749774973   80 ARAGPGIKSLTKY--K-----SR---------------------NKKKVKDKPek---iEKIV--KKKYVYSK------- 119
gi 115772506   82 ARAGPGGKSQLRQ--K-----LKtqktaptnlysnncnnnnpgsLVTEHGWSRrhkrKHAERK--RRMQLLDGlra---- 148
gi 1009407246  80 ARAGPGIKSLTKFkaK-----NK---------------------RKIKDTSDKlakkKHVYVK--T-------------- 117
gi 762078805   80 ARAGPGIKSSMKI--K-----NNk--------------------SPSSSKYKSplksKKMYAH--S-------------- 116
gi 241177521   82 ARAGPGTKCVNKG--K-----VK-----------------------PPKRPLKkhrrRHRLGA--DKRCKMDIggga--- 126
gi 1005947203  80 ARAGPGTKSMKYA--KlnhsnSS---------------------PLTSSTNAKkhqkPKKLKS--SLIDFSDIqgd---- 130
gi 242023042   80 ARAGPGTKSLA----------KF---------------------KAKNKNKKKpklkAEVREI--SPAPSDEL------- 119
gi 345484456   80 ARAGPGIKSLTKF--K-----AKnkkk--------------vvtKEEPEKFEKilkkKRVCLK----------------- 121
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74872681   141 lstsavnrpSST----------SPTS-----------D---H--------------------QHSD-------------S 163
gi 642915185  126 ---------DMTevdflcedgpSGGS-----------SrtaS--------------------PRDS-------------D 152
gi 749774973  120 ---------TEAdr------ehSPAM-----------Sd--ElteyysiaevgsksssrsesPADS-------------D 158
gi 115772506  149 -------rsHPDte------daSP-P-----------Sp--T--------------------PSDA-------------S 168
gi 1009407246 118 ----------ETdr------eqSPLM-----------Sd--D--------------------LIEDytladskassrseS 148
gi 762078805  117 ---------IPSsi------ydMSVN-----------Ed--S--------------------CDKDefe--------gsD 140
gi 241177521  127 ------lsdDVTgr------waPPCL-----------Mp--K--------------------PRD--------------- 146
gi 1005947203 131 ------nfhVPSrr------ipSPIQsdssdldgdsdEd--D--------------------YLSD-------------L 163
gi 242023042  120 ---------SSDls------glSVNS-----------SrpcS--------------------PVQS-------------E 140
gi 345484456  122 ---------NDRdr------eqSPAisddlteeylpg--------------tgskgssragspAES-------------D 159
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74872681   164 NESYDDE----------------------------------QTlpankpyqtrkrtaaaalataneskepnnkrpkltgs 209
gi 642915185  153 SEENVVK----------------------------------NR------------------------------------- 161
gi 749774973  159 DIAE---------------------------------------------------------------------------- 162
gi 115772506  169 DISVASQ----------------------------------PRs------------------------------------ 178
gi 1009407246 149 ISDDDDD----------------------------------IG------------------------------------- 157
gi 762078805  141 SEESEVE----------------------------------ES------------------------------------- 149
gi 241177521      --------------------------------------------------------------------------------
gi 1005947203 164 DDEGKEQgaegafnspkkklrssskspisngllspssssstSR------------------------------------- 206
gi 242023042  141 ECIPKAS----------------------------------RK------------------------------------- 149
gi 345484456  160 DIAVGE-------------------------------------------------------------------------- 165
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 74872681   210 Y----RRRQLV-PQKNRRSVDNIPFFEENDLVRLEVCCGVVFQSLslgSTYYIIDPELYKPCAKH 269
gi 642915185  162 R----HKGQAK-RRDGSSLPDLSDFICPEYWKREAICCGTIFRGM---CGEIIVDNRFLKACSAR 218
gi 749774973  163 K----QIDVPPvENMEVEQSYINDFIDLSYFKREIICCGTIFKGP---YGEVIVDPSLLKPCVGC 220
gi 115772506  179 R----TGLISS-DDLDELPPLLASIIDTSYWKMEKICCGTIFKGV---RGEIMVHPQLLRPCANS 235
gi 1009407246 158 S----NDKQLD-LVQDQDMNEDNDFLDLSYYKREVICCGSIFRGA---NGEIIMYPSSLKPCVNl 214
gi 762078805  150 Q----ENCQRK-NKRKQSDPRISPFLDLSYWKKTEVCCGTIFKGL---NGEVLVDPQLLHPCYTC 206
gi 241177521  147 ------GYLLG-RRAKSAPFRISSFLDMSFWRKEKVCCGIIFKGP---HGEVLIYPKllrpcrcr 201
gi 1005947203 207 R----NLAKRT-KPPTSSLSKVSSFLDMSFWRKEKICCGIIFKGP---NNELLIYPKLLKPCSCR 263
gi 242023042  150 RpkspLHLKED-KHRRSHSPVSSGFVDLDFWKKKKVCCGTIFTGP---HGMVMVDPRLLKPCQGC 210
gi 345484456  166 K----RLDI------DQEQEDISNFIDLTYFKRKNVCCGVIFVGM---MGEVLIEPSLFKPCIGC 217
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap